Outiref
<!DOCTYPE html> <html lang="fr-FR" class="no-js scheme_default"> <head><script>if(navigator.userAgent.match(/MSIE|Internet Explorer/i)||navigator.userAgent.match(/Trident\/7\..*?rv:11/i)){var href=document.location.href;if(!href.match(/[?&]nonitro/)){if(href.indexOf("?")==-1){if(href.indexOf("#")==-1){document.location.href=href+"?nonitro=1"}else{document.location.href=href.replace("#","?nonitro=1#")}}else{if(href.indexOf("#")==-1){document.location.href=href+"&nonitro=1"}else{document.location.href=href.replace("#","&nonitro=1#")}}}}</script><link rel="preconnect" href="https://cdn-fflki.nitrocdn.com" /><link rel="preload" href="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/source/rev-7c1dd13/wp-content/themes/isida/css/fontello/font/03f70c4e51bb097564d6f260409f71c0.fontello.svg#fontello" as="font" type="font/svg" crossorigin class="nitro-font-preload" /><meta charset="UTF-8" /><meta name="viewport" content="width=device-width, initial-scale=1, maximum-scale=1" /><meta name='robots' content='index, follow, max-image-preview:large, max-snippet:-1, max-video-preview:-1' /><title>Chirurgie Esthetique Tunisie ⇒ meilleure agence, prix, chirurgien</title><meta name="description" content="Chirurgie Esthetique Tunisie à Tarifs Exceptionnels ❤ ✅ Séjour Tout Compris à prix pas cher💲meilleur chirurgien 👨‍ clinique 🏥 agence" /><meta property="og:locale" content="fr_FR" /><meta property="og:type" content="website" /><meta property="og:title" content="Chirurgie Esthetique Tunisie ⇒ meilleure agence, prix, chirurgien" /><meta property="og:description" content="Chirurgie Esthetique Tunisie à Tarifs Exceptionnels ❤ ✅ Séjour Tout Compris à prix pas cher💲meilleur chirurgien 👨‍ clinique 🏥 agence" /><meta property="og:url" content="https://www.chirurgies-esthetique-entunisie.com/" /><meta property="og:site_name" content="Chirurgies esthétique en Tunisie" /><meta property="article:modified_time" content="2022-07-20T15:06:46+00:00" /><meta property="og:image" content="https://www.chirurgies-esthetique-entunisie.com/wp-content/uploads/2022/06/290292777_5089201531134059_2674232276719326447_n-1024x452.jpg" /><meta name="twitter:card" content="summary_large_image" /><meta name="twitter:label1" content="Durée de lecture estimée" /><meta name="twitter:data1" content="12 minutes" /><meta name="generator" content="WordPress 6.0.1" /><meta name="generator" content="Site Kit by Google 1.79.1" /><meta name="generator" content="Powered by WPBakery Page Builder - drag and drop page builder for WordPress." /><meta name="msapplication-TileImage" content="https://www.chirurgies-esthetique-entunisie.com/wp-content/uploads/2022/04/cropped-logo-chirurgie-2-270x270.png" /><meta name="generator" content="NitroPack" /><script>var NPSH,NitroScrollHelper;NPSH=NitroScrollHelper=function(){var o=null;var r=history.state;var t=r&&typeof r.nitroScrollPos!=="undefined"&&r.nitroScrollPos&&r.nitroScrollPos>0;var e=t?r.nitroScrollPos:0;function l(){if(r!==null){if(typeof r==="object"){r.nitroScrollPos=window.pageYOffset}}else{r={nitroScrollPos:window.pageYOffset}}history.replaceState(r,"")}window.addEventListener("scroll",function(){if(o!==null)clearTimeout(o);o=setTimeout(l,200)},{passive:true});return{isScrolled:function(){return t},getScrollPos:function(){return e}}}();</script><script>(function(){var a=false;var e=document.documentElement.classList;var i=navigator.userAgent.toLowerCase();var n=["android","iphone","ipad"];var r=n.length;var o;var d=null;for(var t=0;t<r;t++){o=n[t];if(i.indexOf(o)>-1)d=o;if(e.contains(o)){a=true;e.remove(o)}}if(a&&d){e.add(d);if(d=="iphone"||d=="ipad"){e.add("ios")}}})();</script><script type="text/worker" id="nitro-web-worker">var preloadRequests=0;var remainingCount={};var baseURI="";self.onmessage=function(e){switch(e.data.cmd){case"RESOURCE_PRELOAD":var a=e.data.requestId;remainingCount[a]=0;e.data.resources.forEach(function(o){preload(o,function(e){return function(){console.log(e+" DONE: "+o);if(--remainingCount[e]==0){self.postMessage({cmd:"RESOURCE_PRELOAD",requestId:e})}}}(a));remainingCount[a]++});break;case"SET_BASEURI":baseURI=e.data.uri;break}};async function preload(o,a){if(typeof URL!=="undefined"&&baseURI){try{var e=new URL(o,baseURI);o=e.href}catch(e){console.log("Worker error: "+e.message)}}console.log("Preloading "+o);try{var n=new Request(o,{mode:"no-cors",redirect:"follow"});await fetch(n);a()}catch(e){console.log(e);var r=new XMLHttpRequest;r.responseType="blob";r.onload=a;r.onerror=a;r.open("GET",o,true);r.send()}}</script><script id="nprl">(function(e){var t=e.prototype;t.after||(t.after=function(){var e,t=arguments,n=t.length,r=0,i=this,o=i.parentNode,a=Node,c=String,u=document;if(o!==null){while(r<n){(e=t[r])instanceof a?(i=i.nextSibling)!==null?o.insertBefore(e,i):o.appendChild(e):o.appendChild(u.createTextNode(c(e)));++r}}})})(Element);var NPRL,NitroResourceLoader;NPRL=NitroResourceLoader=function(){var r=window.URL||window.webkitURL;var t=true;var f=true;var n=2;var e=null;var q=null;var v;var i;var m=null;var o=null;var a=null;var c={touch:["touchmove","touchend"],default:["mousemove","click","keydown","wheel"]};var u=true;var B=[];var d=false;var p=[];var h=0;var s=0;var H=false;var g=0;var E=null;var D=false;var U=false;var l=false;var _=[];var y=[];var N=[];var b=[];var Y=false;var L={};var w="noModule"in HTMLScriptElement.prototype;var F=requestAnimationFrame||mozRequestAnimationFrame||webkitRequestAnimationFrame||msRequestAnimationFrame;function R(e,t){if(!L[e]){L[e]=[]}L[e].push(t)}function G(e,t){if(L[e]){var n=0,r=L[e];for(var n=0;n<r.length;n++){r[n].call(this,t)}}}function P(){(function(i,t){var n=null;var r=function(e){n(e)};var e=null;var o={};var a=null;var c=null;var u=0;i.addEventListener(t,function(e){if(["load","DOMContentLoaded"].indexOf(t)!=-1){if(c){A(function(){i.triggerNitroEvent(t)})}a=true}else if(t=="readystatechange"){u++;NPh.ogReadyState=u==1?"interactive":"complete";if(c&&c>=u){NPh.documentReadyState=NPh.ogReadyState;A(function(){i.triggerNitroEvent(t)})}}});i.addEventListener(t+"Nitro",function(e){if(["load","DOMContentLoaded"].indexOf(t)!=-1){if(!a){e.preventDefault();e.stopImmediatePropagation()}else{}c=true}else if(t=="readystatechange"){c=NPh.documentReadyState=="interactive"?1:2;if(u<c){e.preventDefault();e.stopImmediatePropagation()}}});switch(t){case"load":e="onload";break;case"readystatechange":e="onreadystatechange";break;case"pageshow":e="onpageshow";break;default:e=null;break}if(e){Object.defineProperty(i,e,{get:function(){return n},set:function(e){if(typeof e!=="function"){n=null;i.removeEventListener(t+"Nitro",r)}else{if(!n){i.addEventListener(t+"Nitro",r)}n=e}}})}Object.defineProperty(i,"addEventListener"+t,{value:function(e){if(e!=t||!NPh.startedScriptLoading||document.currentScript&&document.currentScript.hasAttribute("nitro-exclude")){}else{arguments[0]+="Nitro"}i.ogAddEventListener.apply(i,arguments);o[arguments[1]]=arguments[0]}});Object.defineProperty(i,"removeEventListener"+t,{value:function(e){var t=o[arguments[1]];arguments[0]=t;i.ogRemoveEventListener.apply(i,arguments)}});Object.defineProperty(i,"triggerNitroEvent"+t,{value:function(e,t){t=t||i;var n=new Event(e+"Nitro",{bubbles:true});n.isNitroPack=true;Object.defineProperty(n,"type",{get:function(){return e},set:function(){}});Object.defineProperty(n,"target",{get:function(){return t},set:function(){}});i.dispatchEvent(n)}});if(typeof i.triggerNitroEvent==="undefined"){(function(){var n=i.addEventListener;var r=i.removeEventListener;Object.defineProperty(i,"ogAddEventListener",{value:n});Object.defineProperty(i,"ogRemoveEventListener",{value:r});Object.defineProperty(i,"addEventListener",{value:function(e){var t="addEventListener"+e;if(typeof i[t]!=="undefined"){i[t].apply(i,arguments)}else{n.apply(i,arguments)}}});Object.defineProperty(i,"removeEventListener",{value:function(e){var t="removeEventListener"+e;if(typeof i[t]!=="undefined"){i[t].apply(i,arguments)}else{r.apply(i,arguments)}}});Object.defineProperty(i,"triggerNitroEvent",{value:function(e,t){var n="triggerNitroEvent"+e;if(typeof i[n]!=="undefined"){i[n].apply(i,arguments)}}})})()}}).apply(null,arguments)}P(window,"load");P(window,"pageshow");P(window,"DOMContentLoaded");P(document,"DOMContentLoaded");P(document,"readystatechange");try{var S=new Worker(r.createObjectURL(new Blob([document.getElementById("nitro-web-worker").textContent],{type:"text/javascript"})))}catch(e){var S=new Worker("data:text/javascript;base64,"+btoa(document.getElementById("nitro-web-worker").textContent))}S.onmessage=function(e){if(e.data.cmd=="RESOURCE_PRELOAD"){G(e.data.requestId,e)}};if(typeof document.baseURI!=="undefined"){S.postMessage({cmd:"SET_BASEURI",uri:document.baseURI})}var W=function(e){if(--h==0){A(K)}};var T=function(e){e.target.removeEventListener("load",T);e.target.removeEventListener("error",T);e.target.removeEventListener("nitroTimeout",T);if(e.type!="nitroTimeout"){clearTimeout(e.target.nitroTimeout)}if(--s==0&&h==0){A(Q)}};var X=function(e){var t=e.textContent;try{var n=r.createObjectURL(new Blob([t.replace(/^(?:<!--)?(.*?)(?:-->)?$/gm,"$1")],{type:"text/javascript"}))}catch(e){var n="data:text/javascript;base64,"+btoa(t.replace(/^(?:<!--)?(.*?)(?:-->)?$/gm,"$1"))}return n};var K=function(){NPh.documentReadyState="interactive";document.triggerNitroEvent("readystatechange");document.triggerNitroEvent("DOMContentLoaded");if(window.pageYOffset||window.pageXOffset){window.dispatchEvent(new Event("scroll"))}U=true;A(function(){if(s==0){A(Q)}A(J)})};var Q=function(){if(!U||D)return;D=true;E.disconnect();Z();NPh.documentReadyState="complete";document.triggerNitroEvent("readystatechange");window.triggerNitroEvent("load",document);window.triggerNitroEvent("pageshow",document);if(window.pageYOffset||window.pageXOffset||location.hash){let e=typeof history.scrollRestoration!=="undefined"&&history.scrollRestoration=="auto";if(e&&typeof NPSH!=="undefined"&&NPSH.getScrollPos()>0){window.scrollTo(0,NPSH.getScrollPos())}else if(location.hash){try{let e=document.querySelector(location.hash);if(e){e.scrollIntoView()}}catch(e){}}}var e=null;if(n==1){e=M}else{e=re}A(e)};var A=function(e){setTimeout(e,0)};var O=function(e){if(e.type=="touchend"||e.type=="click"){a=e}};var J=function(){if(a){setTimeout(function(r){return function(){var e=function(e,t,n){var r=new Event(e,{bubbles:true,cancelable:true});if(e=="click"){r.clientX=t;r.clientY=n}else{r.touches=[{clientX:t,clientY:n}]}return r};var t;if(r.type=="touchend"){var n=r.changedTouches[0];t=document.elementFromPoint(n.clientX,n.clientY);t.dispatchEvent(e("touchstart"),n.clientX,n.clientY);t.dispatchEvent(e("touchend"),n.clientX,n.clientY);t.dispatchEvent(e("click"),n.clientX,n.clientY)}else if(r.type=="click"){t=document.elementFromPoint(r.clientX,r.clientY);t.dispatchEvent(e("click"),r.clientX,r.clientY)}}}(a),150);a=null}};var I=function(e){if(e.tagName=="SCRIPT"&&!e.hasAttribute("data-nitro-for-id")&&!e.hasAttribute("nitro-document-write")||e.tagName=="IMG"&&(e.hasAttribute("src")||e.hasAttribute("srcset"))||e.tagName=="IFRAME"&&e.hasAttribute("src")||e.tagName=="LINK"&&e.hasAttribute("href")&&e.hasAttribute("rel")&&e.getAttribute("rel")=="stylesheet"){var t="";switch(e.tagName){case"LINK":t=e.href;break;case"IMG":if(b.indexOf(e)>-1)return;t=e.srcset||e.src;break;default:t=e.src;break}var n=e.getAttribute("type");if(!t&&e.tagName!=="SCRIPT")return;if((e.tagName=="IMG"||e.tagName=="LINK")&&(t.indexOf("data:")===0||t.indexOf("blob:")===0))return;if(e.tagName=="SCRIPT"&&n&&n!=="text/javascript"&&n!=="application/javascript"){if(n!=="module"||!w)return}if(e.tagName==="SCRIPT"){if(b.indexOf(e)>-1)return;if(e.noModule&&w){return}if(!e.src){if(e.textContent.length>0){e.textContent+="\n;if(document.currentScript.nitroTimeout) {clearTimeout(document.currentScript.nitroTimeout);}; setTimeout(function() { this.dispatchEvent(new Event('load')); }.bind(document.currentScript), 0);"}else{return}}b.push(e)}if(!e.hasOwnProperty("nitroTimeout")){s++;e.addEventListener("load",T,true);e.addEventListener("error",T,true);e.addEventListener("nitroTimeout",T,true);e.nitroTimeout=setTimeout(function(){console.log("Resource timed out",e);e.dispatchEvent(new Event("nitroTimeout"))},5e3)}}};var $=function(e){if(e.hasOwnProperty("nitroTimeout")&&e.nitroTimeout){clearTimeout(e.nitroTimeout);e.nitroTimeout=null;e.dispatchEvent(new Event("nitroTimeout"))}};document.documentElement.addEventListener("load",function(e){if(e.target.tagName=="SCRIPT"||e.target.tagName=="IMG"){b.push(e.target)}},true);document.documentElement.addEventListener("error",function(e){if(e.target.tagName=="SCRIPT"||e.target.tagName=="IMG"){b.push(e.target)}},true);var V=["appendChild","replaceChild","insertBefore","prepend","append","before","after","replaceWith","insertAdjacentElement"];var z=function(){V.forEach(function(t){HTMLElement.prototype["og"+t]=HTMLElement.prototype[t];HTMLElement.prototype[t]=function(...e){if(this.parentNode||this===document.documentElement){switch(t){case"replaceChild":case"insertBefore":e.pop();break;case"insertAdjacentElement":e.shift();break}e.forEach(function(e){if(!e)return;if(e.tagName=="SCRIPT"){I(e)}else{if(e.children&&e.children.length>0){e.querySelectorAll("script").forEach(I)}}})}return this["og"+t].apply(this,arguments)}})};var Z=function(){V.forEach(function(e){HTMLElement.prototype[e]=HTMLElement.prototype["og"+e]})};var C=async function(){if(f){j(v);j(O);if(m){clearTimeout(m);m=null}}if(g===1){H=true;return}else if(g===0){g=-1}NPh.startedScriptLoading=true;Object.defineProperty(document,"readyState",{get:function(){return NPh.documentReadyState},set:function(){}});var e=document.documentElement;var t={attributes:true,attributeFilter:["src"],childList:true,subtree:true};E=new MutationObserver(function(e,t){e.forEach(function(e){if(e.type=="childList"&&e.addedNodes.length>0){e.addedNodes.forEach(function(e){if(!document.documentElement.contains(e))return;if(e.tagName=="IMG"||e.tagName=="IFRAME"||e.tagName=="LINK"){I(e)}})}if(e.type=="childList"&&e.removedNodes.length>0){e.removedNodes.forEach(function(e){if(e.tagName=="IFRAME"||e.tagName=="LINK"){$(e)}})}if(e.type=="attributes"){var t=e.target;if(!document.documentElement.contains(t))return;if(t.tagName=="IFRAME"||t.tagName=="LINK"||t.tagName=="IMG"||t.tagName=="SCRIPT"){I(t)}}})});E.observe(e,t);z();await Promise.all(_);var n=p.shift();var r=null;var i=false;while(n){var o;var a=JSON.parse(atob(n.meta));var c=a.delay;if(n.type=="inline"){var u=document.getElementById(n.id);if(u){u.remove()}else{n=p.shift();continue}o=X(u);if(o===false){n=p.shift();continue}}else{o=n.src}if(!i&&n.type!="inline"&&(typeof a.attributes.async!="undefined"||typeof a.attributes.defer!="undefined")){if(r===null){r=n}else if(r===n){i=true}if(!i){p.push(n);n=p.shift();continue}}var d=document.createElement("script");d.src=o;d.setAttribute("data-nitro-for-id",n.id);for(var s in a.attributes){try{if(a.attributes[s]===false){d.setAttribute(s,"")}else{d.setAttribute(s,a.attributes[s])}}catch(e){console.log("Error while setting script attribute",d,e)}}d.async=false;if(c){setTimeout(function(e,t){var n=document.querySelector("[data-nitro-marker-id='"+t+"']");if(n){n.after(e)}else{document.head.appendChild(e)}}.bind(null,d,n.id),c)}else{d.addEventListener("load",W);d.addEventListener("error",W);if(!d.noModule||!w){h++}var l=document.querySelector("[data-nitro-marker-id='"+n.id+"']");if(l){A(function(e,t){return function(){e.after(t)}}(l,d))}else{A(function(e){return function(){document.head.appendChild(e)}}(d))}}n=p.shift()}};var ee=function(){var e=document.getElementById("nitro-deferred-styles");var t=document.createElement("div");t.innerHTML=e.textContent;return t};var M=async function(e){isPreload=e&&e.type=="NitroPreload";if(!isPreload){g=-1;u=false;if(f){j(v);j(O);if(m){clearTimeout(m);m=null}}}if(d===false){var t=ee();let e=t.querySelectorAll('style,link[rel="stylesheet"]');d=e.length;if(d){let e=document.getElementById("nitro-deferred-styles-marker");e.replaceWith.apply(e,t.childNodes)}else if(isPreload){A(k)}else{x()}}else if(d===0&&!isPreload){x()}};var te=function(){var e=ee();var t=e.childNodes;var n;var r=[];for(var i=0;i<t.length;i++){n=t[i];if(n.href){r.push(n.href)}}var o="css-preload";R(o,function(e){M(new Event("NitroPreload"))});if(r.length){S.postMessage({cmd:"RESOURCE_PRELOAD",resources:r,requestId:o})}else{A(function(){G(o)})}};var ne=function(){if(g===-1)return;g=1;var e=[];var t,n;for(var r=0;r<p.length;r++){t=p[r];if(t.type!="inline"){if(t.src){n=JSON.parse(atob(t.meta));if(n.delay)continue;if(n.attributes.type&&n.attributes.type=="module"&&!w)continue;e.push(t.src)}}}if(e.length){var i="js-preload";R(i,function(e){g=2;if(H){A(C)}});S.postMessage({cmd:"RESOURCE_PRELOAD",resources:e,requestId:i})}};var re=function(){while(y.length){style=y.shift();if(style.hasAttribute("nitropack-onload")){style.setAttribute("onload",style.getAttribute("nitropack-onload"));A(function(e){return function(){e.dispatchEvent(new Event("load"))}}(style))}}while(N.length){style=N.shift();if(style.hasAttribute("nitropack-onerror")){style.setAttribute("onerror",style.getAttribute("nitropack-onerror"));A(function(e){return function(){e.dispatchEvent(new Event("error"))}}(style))}}};var k=function(){if(!Y){if(t){A(function(){var e=document.getElementById("nitro-critical-css");if(e){e.remove()}})}Y=true;onStylesLoadEvent=new Event("NitroStylesLoaded");onStylesLoadEvent.isNitroPack=true;window.dispatchEvent(onStylesLoadEvent)}};var x=function(){if(n==2){A(C)}else{re()}};var ie=function(t){i.forEach(function(e){document.addEventListener(e,t,true)})};var j=function(t){i.forEach(function(e){document.removeEventListener(e,t,true)})};return{setAutoRemoveCriticalCss:function(e){t=e},registerScript:function(e,t,n){p.push({type:"remote",src:e,id:t,meta:n})},registerInlineScript:function(e,t){p.push({type:"inline",id:e,meta:t})},registerStyle:function(e,t,n){B.push({href:e,rel:t,media:n})},onLoadStyle:function(e){y.push(e);if(d!==false&&--d==0){A(k);if(u){u=false}else{x()}}},onErrorStyle:function(e){N.push(e);if(d!==false&&--d==0){A(k);if(u){u=false}else{x()}}},loadJs:function(e,t){if(!e.src){var n=X(e);if(n!==false){e.src=n;e.textContent=""}}if(t){A(function(e,t){return function(){e.after(t)}}(t,e))}else{A(function(e){return function(){document.head.appendChild(e)}}(e))}},loadQueuedResources:async function(){if(o){clearTimeout(o);o=null}window.removeEventListener("load",NPRL.loadQueuedResources);v=n==1?C:M;if(!f||a){A(v)}else{if(navigator.userAgent.indexOf(" Edge/")==-1){te();R("css-preload",ne)}ie(v);if(q){if(e){m=setTimeout(v,e)}}else{}}},fontPreload:function(e){var t="critical-fonts";R(t,function(e){document.getElementById("nitro-critical-fonts").type="text/css"});S.postMessage({cmd:"RESOURCE_PRELOAD",resources:e,requestId:t})},boot:function(){let e=history.state;l=typeof NPSH!=="undefined"&&NPSH.getScrollPos()>document.documentElement.clientHeight*.5;if(location.hash||l){f=false}i=c.default.concat(c.touch);o=setTimeout(NPRL.loadQueuedResources,1500);ie(O);if(l){NPRL.loadQueuedResources()}else{window.addEventListener("load",NPRL.loadQueuedResources)}},addPrerequisite:function(e){_.push(e)}}}();var NPh,NitroPackHelper;NPh=NitroPackHelper=function(){var a=document.write;return{documentWrite:function(e,t){if(e&&e.hasAttribute("nitro-exclude")){return a.call(document,t)}var n=null;if(e.documentWriteContainer){n=e.documentWriteContainer}else{n=document.createElement("span");e.documentWriteContainer=n}var r=null;if(e){if(e.hasAttribute("data-nitro-for-id")){r=document.querySelector('template[data-nitro-marker-id="'+e.getAttribute("data-nitro-for-id")+'"]')}else{r=e}}n.innerHTML+=t;n.querySelectorAll("script").forEach(function(e){e.setAttribute("nitro-document-write","")});if(!n.parentNode){if(r){r.parentNode.insertBefore(n,r)}else{document.body.appendChild(n)}}var i=document.createElement("span");i.innerHTML=t;var o=i.querySelectorAll("script");if(o.length){o.forEach(function(t){var e=t.getAttributeNames();var n=document.createElement("script");e.forEach(function(e){n.setAttribute(e,t.getAttribute(e))});n.async=false;if(!t.src&&t.textContent){n.textContent=t.textContent}NPRL.loadJs(n,r)})}},TrustLogo:function(e,t){var n=document.getElementById(e);var r=document.createElement("img");r.src=t;n.parentNode.insertBefore(r,n)},documentReadyState:"loading",ogReadyState:document.readyState,startedScriptLoading:false,loadScriptDelayed:function(t,e){setTimeout(function(){var e=document.createElement("script");e.src=t;document.head.appendChild(e)},e)}}}();document.write=function(e){NPh.documentWrite(document.currentScript,e)};document.writeln=function(e){NPh.documentWrite(document.currentScript,e+"\n")};</script><base href="https://www.chirurgies-esthetique-entunisie.com/" /><template id="nitro-deferred-styles-marker"></template><style type="text/css" id="nitro-critical-css">@charset "UTF-8";ul{box-sizing:border-box;}:root{--wp--preset--font-size--normal:16px;--wp--preset--font-size--huge:42px;}.aligncenter{clear:both;}body{--wp--preset--color--black:#000;--wp--preset--color--cyan-bluish-gray:#abb8c3;--wp--preset--color--white:#fff;--wp--preset--color--pale-pink:#f78da7;--wp--preset--color--vivid-red:#cf2e2e;--wp--preset--color--luminous-vivid-orange:#ff6900;--wp--preset--color--luminous-vivid-amber:#fcb900;--wp--preset--color--light-green-cyan:#7bdcb5;--wp--preset--color--vivid-green-cyan:#00d084;--wp--preset--color--pale-cyan-blue:#8ed1fc;--wp--preset--color--vivid-cyan-blue:#0693e3;--wp--preset--color--vivid-purple:#9b51e0;--wp--preset--gradient--vivid-cyan-blue-to-vivid-purple:linear-gradient(135deg,rgba(6,147,227,1) 0%,#9b51e0 100%);--wp--preset--gradient--light-green-cyan-to-vivid-green-cyan:linear-gradient(135deg,#7adcb4 0%,#00d082 100%);--wp--preset--gradient--luminous-vivid-amber-to-luminous-vivid-orange:linear-gradient(135deg,rgba(252,185,0,1) 0%,rgba(255,105,0,1) 100%);--wp--preset--gradient--luminous-vivid-orange-to-vivid-red:linear-gradient(135deg,rgba(255,105,0,1) 0%,#cf2e2e 100%);--wp--preset--gradient--very-light-gray-to-cyan-bluish-gray:linear-gradient(135deg,#eee 0%,#a9b8c3 100%);--wp--preset--gradient--cool-to-warm-spectrum:linear-gradient(135deg,#4aeadc 0%,#9778d1 20%,#cf2aba 40%,#ee2c82 60%,#fb6962 80%,#fef84c 100%);--wp--preset--gradient--blush-light-purple:linear-gradient(135deg,#ffceec 0%,#9896f0 100%);--wp--preset--gradient--blush-bordeaux:linear-gradient(135deg,#fecda5 0%,#fe2d2d 50%,#6b003e 100%);--wp--preset--gradient--luminous-dusk:linear-gradient(135deg,#ffcb70 0%,#c751c0 50%,#4158d0 100%);--wp--preset--gradient--pale-ocean:linear-gradient(135deg,#fff5cb 0%,#b6e3d4 50%,#33a7b5 100%);--wp--preset--gradient--electric-grass:linear-gradient(135deg,#caf880 0%,#71ce7e 100%);--wp--preset--gradient--midnight:linear-gradient(135deg,#020381 0%,#2874fc 100%);--wp--preset--duotone--dark-grayscale:url("#wp-duotone-dark-grayscale");--wp--preset--duotone--grayscale:url("#wp-duotone-grayscale");--wp--preset--duotone--purple-yellow:url("#wp-duotone-purple-yellow");--wp--preset--duotone--blue-red:url("#wp-duotone-blue-red");--wp--preset--duotone--midnight:url("#wp-duotone-midnight");--wp--preset--duotone--magenta-yellow:url("#wp-duotone-magenta-yellow");--wp--preset--duotone--purple-green:url("#wp-duotone-purple-green");--wp--preset--duotone--blue-orange:url("#wp-duotone-blue-orange");--wp--preset--font-size--small:13px;--wp--preset--font-size--medium:20px;--wp--preset--font-size--large:36px;--wp--preset--font-size--x-large:42px;}.wpcf7 form .wpcf7-response-output{margin:2em .5em 1em;padding:.2em 1em;border:2px solid #00a0d2;}.wpcf7 form.init .wpcf7-response-output{display:none;}.wpcf7-form-control-wrap{position:relative;}.wpcf7 input[type="tel"]{direction:ltr;}.sp-easy-accordion *{box-sizing:border-box;}.sp-easy-accordion .sp-ea-single .ea-body{padding:15px;background:#fff;border-top:none;}.sp-easy-accordion .sp-ea-single .ea-body p:last-of-type{padding-bottom:0;margin-bottom:0;}.sp-easy-accordion>.sp-ea-single>.sp-collapse>.ea-body p:first-of-type{padding-top:0;margin-top:0;}.sp-ea-one.sp-easy-accordion .sp-ea-single .ea-body{padding:15px;}.spcollapse:not(.show){display:none;}#sp-ea-4002.sp-easy-accordion>.sp-ea-single>.sp-collapse>.ea-body{background:#fff;color:#444;}.entry-content ul li:before{content:" " !important;}.entry-content ul{list-style-type:none !important;}#page_preloader{background-color:#f0f0f0;background-position:center;background-repeat:no-repeat;position:fixed;z-index:1000000;left:0;top:0;right:0;bottom:0;opacity:.8;}.preloader_wrap{position:absolute;display:inline-block;left:50%;top:50%;-webkit-transform:translateX(-50%) translateY(-50%);-moz-transform:translateX(-50%) translateY(-50%);-ms-transform:translateX(-50%) translateY(-50%);transform:translateX(-50%) translateY(-50%);}.preloader_wrap>div{height:10px;width:10px;background-color:#efa758;}.preloader_wrap>div[class*="preloader_circ"]{margin-right:5px;border-radius:50%;display:inline-block;-webkit-animation:preloader-circle .7s infinite ease-in-out;animation:preloader-circle .7s infinite ease-in-out;}.preloader_wrap>div.preloader_circ2{-webkit-animation-delay:-.6s;animation-delay:-.6s;}.preloader_wrap>div.preloader_circ3{-webkit-animation-delay:-.5s;animation-delay:-.5s;}.preloader_wrap>div.preloader_circ4{-webkit-animation-delay:-.4s;animation-delay:-.4s;}@-webkit-keyframes preloader-circle{0%,40%,100%{-webkit-transform:translateY(-10px);}20%{-webkit-transform:translateY(-20px);}}@keyframes preloader-circle{0%,40%,100%{transform:translateY(-10px);-webkit-transform:translateY(-10px);}20%{transform:translateY(-20px);-webkit-transform:translateY(-20px);}}html{overflow-y:scroll !important;}.clearfix:before,.clearfix:after{content:" ";display:table;}.clearfix:after{clear:both;width:100%;height:0;display:block;}html,body,div,span,h1,h2,p,a,strong,ul,li,label,input,article,aside{font-family:inherit;font-size:100%;font-style:inherit;font-weight:inherit;line-height:inherit;border:0;outline:0;-webkit-font-smoothing:antialiased;-ms-word-wrap:break-word;word-wrap:break-word;}html,body{margin:0;padding:0;width:100%;}html{height:100%;font-size:100%;overflow-y:scroll !important;overflow-x:hidden;-webkit-text-size-adjust:100%;-ms-text-size-adjust:100%;}html{font-size:15px;}body{text-rendering:optimizeLegibility;}article,aside,figure,header,nav{display:block;}li>ul{margin-bottom:0;}ul{padding-left:1.5em;}a{text-decoration:none;background:transparent;}a{outline:0;}a img{border:none;}:active,:focus{outline:0;}strong{font-weight:bold;}template{display:none;}img{max-width:100%;height:auto;vertical-align:top;}figure{border:0;margin:0;padding:0;overflow:hidden;position:relative;max-width:100%;}[class*=" icon-"]:before{line-height:inherit;font-weight:inherit;font-size:inherit;width:auto;margin:0;}input,select{font-family:inherit;font-size:1em;margin:0;vertical-align:baseline;}input::-moz-focus-inner{border:0;padding:0;}select,option,input[type="text"],input[type="tel"]{-webkit-box-sizing:border-box;-moz-box-sizing:border-box;box-sizing:border-box;-webkit-border-radius:0;-moz-border-radius:0;-ms-border-radius:0;border-radius:0;}input::-moz-focus-inner{border:0;padding:0;}input[type="text"],input[type="tel"],select{-webkit-appearance:none;outline:none;resize:none;padding:1.4em 1.4em;border:1px solid #ddd;}.aligncenter{clear:both;display:block !important;margin-left:auto !important;margin-right:auto !important;text-align:center;}.vc_row{margin-left:-15px;margin-right:-15px;}.vc_column_container>.vc_column-inner{padding-left:15px;padding-right:15px;}.clearfix:before,.clearfix:after{content:" ";display:table;}.clearfix:after{clear:both;width:100%;height:0;display:block;}.page_wrap{min-height:100vh;}.page_wrap,.content_wrap{margin:0 auto;}#page_preloader{background-color:#f0f0f0;}.content_wrap{width:1170px;margin:0 auto;}.content_wrap:after{content:" ";display:block;width:100%;height:0;clear:both;}.content{-webkit-box-sizing:border-box;-moz-box-sizing:border-box;box-sizing:border-box;}.page_content_wrap .content_wrap{position:relative;}.sidebar_hide .content{margin-left:auto;margin-right:auto;}.top_panel_top .content_wrap:after{content:none;}.top_panel_top .content_wrap{display:flex;display:-webkit-flex;display:-ms-flexbox;display:-webkit-flex;justify-content:space-between;-webkit-justify-content:space-between;align-items:center;-webkit-align-items:center;flex-direction:row;-webkit-flex-direction:row;padding:.536em 0;font-size:.867rem;}.top_panel_top .info_phone_number{font-size:1.133rem;font-weight:600;}.top_panel{position:relative;z-index:10000;background-position:center;background-repeat:no-repeat;background-size:cover;padding:.1px 0;margin-bottom:7.4rem;}.remove_margins .top_panel{margin-bottom:0;}.top_panel_fixed_wrap{display:none;}.logo{position:relative;z-index:1;display:block;}.top_panel .logo{float:left;text-align:left;max-width:40%;}.logo img{display:inline-block;margin:0;max-width:100%;max-height:3.6rem;width:auto;}.top_panel_navi{position:relative;z-index:3;padding-top:2.31em;}.top_panel_navi .content_wrap{position:relative;}.header_title_off .top_panel_navi{padding-bottom:2.4em;}.menu_main_nav_area{float:right;text-align:left;max-width:80%;display:block;-webkit-box-sizing:border-box;-moz-box-sizing:border-box;-ms-box-sizing:border-box;box-sizing:border-box;padding-right:0;visibility:hidden;padding-top:.35rem;}.menu_main_nav,.menu_main_nav ul{display:inline-block;margin:0;padding:0;list-style-type:none;}.menu_main_nav:after,.menu_main_nav ul:after{content:" ";display:block;width:100%;height:0;clear:both;}.menu_main_nav li{margin:0;position:relative;}.menu_main_nav li>a{display:block;position:relative;}.menu_main_nav{text-align:left;vertical-align:middle;}.menu_main_nav>li{position:relative;float:left;z-index:20;}.menu_main_nav>li+li{z-index:19;}.menu_main_nav>li+li+li{z-index:18;}.menu_main_nav>li+li+li+li{z-index:17;}.menu_main_nav>li>a{padding:1.353em 1em 1.153em;position:relative;}.menu_main_nav>li.menu-item-has-children>a:after{content:"";content:none;font-family:"fontello";font-weight:normal;display:inline-block;position:absolute;position:static;top:44%;right:1em;z-index:1;-webkit-transform:translateY(-50%);-webkit-transform:none;-moz-transform:translateY(-50%);-moz-transform:none;-ms-transform:translateY(-50%);-ms-transform:none;transform:translateY(-50%);transform:none;padding-left:.3em;}.menu_main_nav li li.menu-item-has-children>a:after{content:"";font-family:"fontello";font-weight:normal;position:absolute;position:static;right:1em;top:50%;margin-top:-1em;margin:0 0 0 .5em;}.menu_main_nav>li.menu_item_button>a{padding-left:1.5em;padding-right:1.5em;-webkit-border-radius:3em;-moz-border-radius:3em;-ms-border-radius:3em;border-radius:3em;-webkit-box-sizing:border-box;-moz-box-sizing:border-box;box-sizing:border-box;}.menu_main_nav>li+li.menu_item_button>a{margin-left:.8em;}.menu_main_nav>li ul{position:absolute;display:none;z-index:10000;width:12.9em;padding:2em 0;text-align:left;-webkit-box-sizing:border-box;-moz-box-sizing:border-box;-ms-box-sizing:border-box;box-sizing:border-box;}.menu_main_nav>li>ul:before{content:"";position:absolute;left:10%;top:-16px;border:8px solid transparent;}.menu_main_nav>li ul>li>a{padding:.4em 1.6667em .4em 18%;}.menu_main_nav>li>ul{top:3.5em;left:0;margin-left:0;}.menu_main_nav>li>ul ul{left:12.8em;top:-2.02em;margin:0 0 0 2px;}.no_layout .top_panel_navi{visibility:hidden;}.menu_mobile_button{display:none;width:1.2em;height:1.2em;position:absolute;right:0;top:0;-webkit-box-sizing:border-box;-moz-box-sizing:border-box;box-sizing:border-box;}.menu_mobile_close{display:block;width:5em;height:5em;position:absolute;right:0;top:0;}.menu_mobile_close:before,.menu_mobile_close:after{content:" ";position:absolute;z-index:2;left:38%;top:50%;width:25%;height:0;margin-top:-1px;-webkit-box-sizing:border-box;-moz-box-sizing:border-box;box-sizing:border-box;border-top:2px solid #fff;}.menu_mobile_close:before{-webkit-transform:rotate(45deg);-moz-transform:rotate(45deg);-ms-transform:rotate(45deg);transform:rotate(45deg);}.menu_mobile_close:after{-webkit-transform:rotate(-45deg);-moz-transform:rotate(-45deg);-ms-transform:rotate(-45deg);transform:rotate(-45deg);}.menu_mobile_overlay{display:none !important;position:fixed;z-index:100000;left:0;top:0;right:0;bottom:0;background-color:rgba(0,0,0,.8);}.menu_mobile{position:fixed;z-index:100002;left:0;top:0;height:100%;width:0;}.menu_mobile_inner{position:absolute;z-index:1;left:0;top:0;right:0;bottom:0;width:100%;height:100%;text-align:center;overflow:hidden;}.menu_mobile a{display:block;}.menu_mobile .logo{text-align:center;margin:4.4rem 0 0;}.menu_mobile .menu_mobile_nav_area{position:absolute;z-index:1;left:0;top:48%;width:100%;height:auto;max-height:44%;padding-right:20px;overflow-y:scroll;-webkit-transform:translateY(-50%);-moz-transform:translateY(-50%);-ms-transform:translateY(-50%);transform:translateY(-50%);padding-left:3%;overflow-x:hidden;}.menu_mobile .menu_mobile_nav_area ul{margin:0 auto;padding:0;list-style:none;width:auto;}.menu_mobile .menu_mobile_nav_area ul ul{margin:.6em 0 1.6em;display:none;}.menu_mobile .menu_mobile_nav_area li{margin-bottom:0;width:auto;}.menu_mobile .menu_mobile_nav_area li>a{font-size:1.3333em;line-height:1.5em;padding:.15em 2.5em .15em 0;text-transform:uppercase;letter-spacing:2px;position:relative;display:inline-block;width:28rem;text-align:left;-webkit-box-sizing:border-box;-moz-box-sizing:border-box;-ms-box-sizing:border-box;box-sizing:border-box;}.menu_mobile .menu_mobile_nav_area>ul>li>a{font-size:2.3333em;line-height:1.5em;}.menu_mobile .menu_mobile_nav_area>ul>li li>a{padding-left:0em;}.menu_mobile .menu_mobile_nav_area>ul>li li li>a{padding-left:1em;}.header_widgets_wrap{position:relative;z-index:2;}.header_widgets_wrap.header_fullwidth{overflow:hidden;}.header_widgets_wrap.header_fullwidth aside{margin-bottom:0;}.wpb_row,.wpb_text_column,.wpb_content_element{margin-bottom:0 !important;}:root{--joinchat-ico:url("data:image/svg+xml;charset=utf-8,%3Csvg xmlns=\'http://www.w3.org/2000/svg\' viewBox=\'0 0 24 24\'%3E%3Cpath fill=\'%23fff\' d=\'M3.516 3.516c4.686-4.686 12.284-4.686 16.97 0 4.686 4.686 4.686 12.283 0 16.97a12.004 12.004 0 0 1-13.754 2.299l-5.814.735a.392.392 0 0 1-.438-.44l.748-5.788A12.002 12.002 0 0 1 3.517 3.517zm3.61 17.043.3.158a9.846 9.846 0 0 0 11.534-1.758c3.843-3.843 3.843-10.074 0-13.918-3.843-3.843-10.075-3.843-13.918 0a9.846 9.846 0 0 0-1.747 11.554l.16.303-.51 3.942a.196.196 0 0 0 .219.22l3.961-.501zm6.534-7.003-.933 1.164a9.843 9.843 0 0 1-3.497-3.495l1.166-.933a.792.792 0 0 0 .23-.94L9.561 6.96a.793.793 0 0 0-.924-.445 1291.6 1291.6 0 0 0-2.023.524.797.797 0 0 0-.588.88 11.754 11.754 0 0 0 10.005 10.005.797.797 0 0 0 .88-.587l.525-2.023a.793.793 0 0 0-.445-.923L14.6 13.327a.792.792 0 0 0-.94.23z\'/%3E%3C/svg%3E");--joinchat-font:-apple-system,blinkmacsystemfont,"Segoe UI",roboto,oxygen-sans,ubuntu,cantarell,"Helvetica Neue",sans-serif;}.joinchat{--bottom:20px;--sep:20px;--s:60px;display:none;position:fixed;z-index:9999;right:var(--sep);bottom:var(--bottom);font:normal normal normal 16px/1.625em var(--joinchat-font);letter-spacing:0;animation:joinchat_show .5s cubic-bezier(.18,.89,.32,1.28) 10ms both;transform:scale3d(0,0,0);transform-origin:calc(var(--s) / -2) calc(var(--s) / -4);touch-action:manipulation;-webkit-font-smoothing:antialiased;}.joinchat *,.joinchat :after,.joinchat :before{box-sizing:border-box;}.joinchat__button{position:absolute;z-index:2;bottom:8px;right:8px;height:var(--s);min-width:var(--s);max-width:95vw;background:#25d366;color:inherit;border-radius:calc(var(--s) / 2);box-shadow:1px 6px 24px 0 rgba(7,94,84,.24);}.joinchat__button__open{width:var(--s);height:var(--s);border-radius:50%;background:rgba(0,0,0,0) var(--joinchat-ico) 50% no-repeat;background-size:60%;overflow:hidden;}@keyframes joinchat_show{0%{transform:scale3d(0,0,0);}to{transform:scaleX(1);}}@media (max-width:480px),(orientation:landscape) and (max-height:480px){.joinchat{--bottom:6px;--sep:6px;}}@media (prefers-reduced-motion){.joinchat{animation:none;}}.vc_row:after,.vc_row:before{content:" ";display:table;}.vc_row:after{clear:both;}.vc_column_container{width:100%;}.vc_row{margin-left:-15px;margin-right:-15px;}.vc_col-sm-12,.vc_col-sm-4{position:relative;min-height:1px;padding-left:15px;padding-right:15px;-webkit-box-sizing:border-box;-moz-box-sizing:border-box;box-sizing:border-box;}@media (min-width:768px){.vc_col-sm-12,.vc_col-sm-4{float:left;}.vc_col-sm-12{width:100%;}.vc_col-sm-4{width:33.33333333%;}}.vc_clearfix:after,.vc_clearfix:before{content:" ";display:table;}.vc_clearfix:after{clear:both;}.vc_clearfix:after,.vc_clearfix:before{content:" ";display:table;}.vc_clearfix:after{clear:both;}.wpb_text_column :last-child,.wpb_text_column p:last-child{margin-bottom:0;}.wpb_content_element{margin-bottom:35px;}.vc_row.vc_row-no-padding .vc_column-inner{padding-left:0;padding-right:0;}.vc_row[data-vc-full-width]{overflow:hidden;}.vc_column-inner::after,.vc_column-inner::before{content:" ";display:table;}.vc_column-inner::after{clear:both;}.vc_column_container{padding-left:0;padding-right:0;}.vc_column_container>.vc_column-inner{box-sizing:border-box;padding-left:15px;padding-right:15px;width:100%;}.vc_row-has-fill+.vc_row-full-width+.vc_row>.vc_column_container>.vc_column-inner,.vc_row-has-fill>.vc_column_container>.vc_column-inner{padding-top:35px;}.wpb_single_image img{height:auto;max-width:100%;vertical-align:top;}.wpb_single_image .vc_single_image-wrapper{display:inline-block;vertical-align:top;max-width:100%;}.wpb_single_image.vc_align_center{text-align:center;}.wpb_single_image .vc_figure{display:inline-block;vertical-align:top;margin:0;max-width:100%;}[class*=" icon-"]:before{font-family:"fontello";font-style:normal;font-weight:normal;speak:none;display:inline-block;text-decoration:inherit;width:1em;margin-right:.2em;text-align:center;font-variant:normal;text-transform:none;line-height:1em;margin-left:.2em;}.icon-cancel:before{content:"";}.icon-menu-2:before{content:"";}html,body,div,span,h1,h2,p,a,strong,ul,li,label,input,article,aside{font-family:inherit;font-size:100%;font-style:inherit;font-weight:inherit;line-height:inherit;border:0;outline:0;-webkit-font-smoothing:antialiased;-ms-word-wrap:break-word;word-wrap:break-word;}html,body{margin:0;padding:0;width:100%;}html{height:100%;font-size:100%;overflow-y:scroll !important;overflow-x:hidden;-webkit-text-size-adjust:100%;-ms-text-size-adjust:100%;}html{font-size:15px;}body{text-rendering:optimizeLegibility;}article,aside,figure,header,nav{display:block;}li>ul{margin-bottom:0;}ul{padding-left:1.5em;}a{text-decoration:none;background:transparent;}a{outline:0;}a img{border:none;}:active,:focus{outline:0;}strong{font-weight:bold;}template{display:none;}img{max-width:100%;height:auto;vertical-align:top;}figure{border:0;margin:0;padding:0;overflow:hidden;position:relative;max-width:100%;}[class*=" icon-"]:before{line-height:inherit;font-weight:inherit;font-size:inherit;width:auto;margin:0;}input,select{font-family:inherit;font-size:1em;margin:0;vertical-align:baseline;}input::-moz-focus-inner{border:0;padding:0;}select,option,input[type="text"],input[type="tel"]{-webkit-box-sizing:border-box;-moz-box-sizing:border-box;box-sizing:border-box;-webkit-border-radius:0;-moz-border-radius:0;-ms-border-radius:0;border-radius:0;}input::-moz-focus-inner{border:0;padding:0;}input[type="text"],input[type="tel"],select{-webkit-appearance:none;outline:none;resize:none;padding:1.4em 1.4em;border:1px solid #ddd;}.aligncenter{clear:both;display:block !important;margin-left:auto !important;margin-right:auto !important;text-align:center;}.vc_row{margin-left:-15px;margin-right:-15px;}.vc_column_container>.vc_column-inner{padding-left:15px;padding-right:15px;}.clearfix:before,.clearfix:after{content:" ";display:table;}.clearfix:after{clear:both;width:100%;height:0;display:block;}.page_wrap{min-height:100vh;}.page_wrap,.content_wrap{margin:0 auto;}#page_preloader{background-color:#f0f0f0;}.content_wrap{width:1170px;margin:0 auto;}.content_wrap:after{content:" ";display:block;width:100%;height:0;clear:both;}.content{-webkit-box-sizing:border-box;-moz-box-sizing:border-box;box-sizing:border-box;}.page_content_wrap .content_wrap{position:relative;}.sidebar_hide .content{margin-left:auto;margin-right:auto;}.top_panel_top .content_wrap:after{content:none;}.top_panel_top .content_wrap{display:flex;display:-webkit-flex;display:-ms-flexbox;display:-webkit-flex;justify-content:space-between;-webkit-justify-content:space-between;align-items:center;-webkit-align-items:center;flex-direction:row;-webkit-flex-direction:row;padding:.536em 0;font-size:.867rem;}.top_panel_top .info_phone_number{font-size:1.133rem;font-weight:600;}.top_panel{position:relative;z-index:10000;background-position:center;background-repeat:no-repeat;background-size:cover;padding:.1px 0;margin-bottom:7.4rem;}.remove_margins .top_panel{margin-bottom:0;}.top_panel_fixed_wrap{display:none;}.logo{position:relative;z-index:1;display:block;}.top_panel .logo{float:left;text-align:left;max-width:40%;}.logo img{display:inline-block;margin:0;max-width:100%;max-height:3.6rem;width:auto;}.top_panel_navi{position:relative;z-index:3;padding-top:2.31em;}.top_panel_navi .content_wrap{position:relative;}.header_title_off .top_panel_navi{padding-bottom:2.4em;}.menu_main_nav_area{float:right;text-align:left;max-width:80%;display:block;-webkit-box-sizing:border-box;-moz-box-sizing:border-box;-ms-box-sizing:border-box;box-sizing:border-box;padding-right:0;visibility:hidden;padding-top:.35rem;}.menu_main_nav,.menu_main_nav ul{display:inline-block;margin:0;padding:0;list-style-type:none;}.menu_main_nav:after,.menu_main_nav ul:after{content:" ";display:block;width:100%;height:0;clear:both;}.menu_main_nav li{margin:0;position:relative;}.menu_main_nav li>a{display:block;position:relative;}.menu_main_nav{text-align:left;vertical-align:middle;}.menu_main_nav>li{position:relative;float:left;z-index:20;}.menu_main_nav>li+li{z-index:19;}.menu_main_nav>li+li+li{z-index:18;}.menu_main_nav>li+li+li+li{z-index:17;}.menu_main_nav>li>a{padding:1.353em 1em 1.153em;position:relative;}.menu_main_nav>li.menu-item-has-children>a:after{content:"";content:none;font-family:"fontello";font-weight:normal;display:inline-block;position:absolute;position:static;top:44%;right:1em;z-index:1;-webkit-transform:translateY(-50%);-webkit-transform:none;-moz-transform:translateY(-50%);-moz-transform:none;-ms-transform:translateY(-50%);-ms-transform:none;transform:translateY(-50%);transform:none;padding-left:.3em;}.menu_main_nav li li.menu-item-has-children>a:after{content:"";font-family:"fontello";font-weight:normal;position:absolute;position:static;right:1em;top:50%;margin-top:-1em;margin:0 0 0 .5em;}.menu_main_nav>li.menu_item_button>a{padding-left:1.5em;padding-right:1.5em;-webkit-border-radius:3em;-moz-border-radius:3em;-ms-border-radius:3em;border-radius:3em;-webkit-box-sizing:border-box;-moz-box-sizing:border-box;box-sizing:border-box;}.menu_main_nav>li+li.menu_item_button>a{margin-left:.8em;}.menu_main_nav>li ul{position:absolute;display:none;z-index:10000;width:12.9em;padding:2em 0;text-align:left;-webkit-box-sizing:border-box;-moz-box-sizing:border-box;-ms-box-sizing:border-box;box-sizing:border-box;}.menu_main_nav>li>ul:before{content:"";position:absolute;left:10%;top:-16px;border:8px solid transparent;}.menu_main_nav>li ul>li>a{padding:.4em 1.6667em .4em 18%;}.menu_main_nav>li>ul{top:3.5em;left:0;margin-left:0;}.menu_main_nav>li>ul ul{left:12.8em;top:-2.02em;margin:0 0 0 2px;}.no_layout .top_panel_navi{visibility:hidden;}.menu_mobile_button{display:none;width:1.2em;height:1.2em;position:absolute;right:0;top:0;-webkit-box-sizing:border-box;-moz-box-sizing:border-box;box-sizing:border-box;}.menu_mobile_close{display:block;width:5em;height:5em;position:absolute;right:0;top:0;}.menu_mobile_close:before,.menu_mobile_close:after{content:" ";position:absolute;z-index:2;left:38%;top:50%;width:25%;height:0;margin-top:-1px;-webkit-box-sizing:border-box;-moz-box-sizing:border-box;box-sizing:border-box;border-top:2px solid #fff;}.menu_mobile_close:before{-webkit-transform:rotate(45deg);-moz-transform:rotate(45deg);-ms-transform:rotate(45deg);transform:rotate(45deg);}.menu_mobile_close:after{-webkit-transform:rotate(-45deg);-moz-transform:rotate(-45deg);-ms-transform:rotate(-45deg);transform:rotate(-45deg);}.menu_mobile_overlay{display:none !important;position:fixed;z-index:100000;left:0;top:0;right:0;bottom:0;background-color:rgba(0,0,0,.8);}.menu_mobile{position:fixed;z-index:100002;left:0;top:0;height:100%;width:0;}.menu_mobile_inner{position:absolute;z-index:1;left:0;top:0;right:0;bottom:0;width:100%;height:100%;text-align:center;overflow:hidden;}.menu_mobile a{display:block;}.menu_mobile .logo{text-align:center;margin:4.4rem 0 0;}.menu_mobile .menu_mobile_nav_area{position:absolute;z-index:1;left:0;top:48%;width:100%;height:auto;max-height:44%;padding-right:20px;overflow-y:scroll;-webkit-transform:translateY(-50%);-moz-transform:translateY(-50%);-ms-transform:translateY(-50%);transform:translateY(-50%);padding-left:3%;overflow-x:hidden;}.menu_mobile .menu_mobile_nav_area ul{margin:0 auto;padding:0;list-style:none;width:auto;}.menu_mobile .menu_mobile_nav_area ul ul{margin:.6em 0 1.6em;display:none;}.menu_mobile .menu_mobile_nav_area li{margin-bottom:0;width:auto;}.menu_mobile .menu_mobile_nav_area li>a{font-size:1.3333em;line-height:1.5em;padding:.15em 2.5em .15em 0;text-transform:uppercase;letter-spacing:2px;position:relative;display:inline-block;width:28rem;text-align:left;-webkit-box-sizing:border-box;-moz-box-sizing:border-box;-ms-box-sizing:border-box;box-sizing:border-box;}.menu_mobile .menu_mobile_nav_area>ul>li>a{font-size:2.3333em;line-height:1.5em;}.menu_mobile .menu_mobile_nav_area>ul>li li>a{padding-left:0em;}.menu_mobile .menu_mobile_nav_area>ul>li li li>a{padding-left:1em;}.header_widgets_wrap{position:relative;z-index:2;}.header_widgets_wrap.header_fullwidth{overflow:hidden;}.header_widgets_wrap.header_fullwidth aside{margin-bottom:0;}.wpb_row,.wpb_text_column,.wpb_content_element{margin-bottom:0 !important;}.top_panel{padding:0;}.top_panel .logo{max-width:inherit;}.top_panel .logo img{max-width:inherit;max-height:inherit;}header .top_panel_navi,.header_title_off .top_panel_navi{padding:15px 0;}.menu_main_nav>li>a{padding-left:10px;padding-right:10px;}.open_hours a{color:#fff;}.top_panel_top,.open_hours,.info_phone{font-size:1.133rem;}.wpcf7-form input[type="text"],.wpcf7-form input[type="tel"],.wpcf7-form select{padding:10px 20px;width:100%;margin:10px 0;}.wpcf7-form select{margin:0;}.scheme_default .wpcf7-form input::-webkit-input-placeholder{opacity:1;}.scheme_default .wpcf7-form input::-moz-placeholder{opacity:1;}.scheme_default .wpcf7-form input:-ms-input-placeholder{opacity:1;}.scheme_default .wpcf7-form input:-moz-placeholder{opacity:1;}.menu_mobile .logo{margin:1.4rem 0 0;}.menu_main_nav_area{max-width:88%;}.menu_main_nav>li ul{width:15em;}.wpcf7-response-output{float:left;}@media (min-width:1440px) and (max-width:1679px){body{font-size:1.1em;}}@media (min-width:1263px) and (max-width:1439px){.menu_main_nav>li>a{padding-left:.5em !important;padding-right:.5em !important;font-size:.8rem !important;}html body{font-size:1.1em;}}@media (max-width:1262px){.logo img{max-height:inherit;}}@media (max-width:480px){.menu_mobile .menu_mobile_nav_area li>a{width:20rem;}}body{font-family:"PT Sans",sans-serif;font-size:1.1em;font-weight:400;font-style:normal;line-height:1.6em;text-decoration:none;text-transform:none;}p,ul{margin-top:0em;margin-bottom:1.4em;}h1{font-family:"Josefin Sans",sans-serif;font-size:4.667em;font-weight:400;font-style:normal;line-height:.97em;text-decoration:none;text-transform:uppercase;margin-top:.9583em;margin-bottom:.5833em;}h2{font-family:"PT Sans",sans-serif;font-size:2.2em;font-weight:400;font-style:normal;line-height:1.1em;text-decoration:none;text-transform:uppercase;margin-top:1.0444em;margin-bottom:.76em;}.wpb_text_column h1:last-child{margin-bottom:.5833em;}.wpb_text_column h2:last-child{margin-bottom:.76em;}input[type="text"],input[type="tel"],select{font-family:"PT Sans",sans-serif;font-size:1em;font-weight:400;font-style:normal;line-height:1.47em;text-decoration:none;text-transform:none;}.menu_main_nav_area{font-size:.8533rem;line-height:1em;}.menu_main_nav>li,.menu_main_nav>li>a{font-size:.8533rem;font-family:"Josefin Sans",sans-serif;font-weight:700;font-style:normal;text-decoration:none;text-transform:uppercase;}.menu_mobile .menu_mobile_nav_area>ul>li,.menu_mobile .menu_mobile_nav_area>ul>li>a{font-family:"Josefin Sans",sans-serif;}.menu_main_nav>li li,.menu_main_nav>li li>a{font-family:"Josefin Sans",sans-serif;font-size:.8533rem;font-weight:700;font-style:normal;line-height:1.3em;text-decoration:none;text-transform:uppercase;}.menu_mobile .menu_mobile_nav_area>ul>li li,.menu_mobile .menu_mobile_nav_area>ul>li li>a{font-family:"Josefin Sans",sans-serif;}.scheme_default h1,.scheme_default h2,.scheme_default li a{color:#1a281e;}.scheme_default a{color:#35769e;}.scheme_default ul>li:before{color:#35769e;}.scheme_default input[type="text"],.scheme_default input[type="tel"]{color:#8d989a;border-color:#e7e7e7;background-color:#fff;}.scheme_default input::-webkit-input-placeholder{color:#8d989a;}.scheme_default body{color:#595b5a;background-color:#fff;}.scheme_default #page_preloader,.scheme_default .page_wrap{background-color:#fff;}.scheme_default .preloader_wrap>div{background-color:#35769e;}.scheme_default .top_panel_top_wrap{background-color:#000b3d;color:#fff;}.scheme_default .top_panel_top .info_phone_number{color:#35769e;font-family:"Josefin Sans",sans-serif;}.scheme_default .menu_main_nav>li>a{color:#35769e;}.scheme_default .menu_main_nav>li.menu_item_button>a{background-color:#35769e;color:#fff;}.scheme_default .menu_main_nav>li ul{background-color:#000b3d;}.scheme_default .menu_main_nav>li>ul:before{border-bottom-color:#000b3d;}.scheme_default .menu_main_nav>li li>a{color:#8d989a;}.scheme_default .menu_mobile_inner{color:#35769e;background-color:#f7f7f7;}.scheme_default .menu_mobile_button{color:#1a281e;}.scheme_default .menu_mobile_close:before,.scheme_default .menu_mobile_close:after{border-color:#231f20;}.scheme_default .menu_mobile_inner a{color:#231f20;}.scheme_default aside{color:#35769e;}.vc_col-sm-12{min-height:0;}.vc_row-has-fill+.vc_row-full-width+.vc_row>.vc_column_container>.vc_column-inner,.vc_row-has-fill>.vc_column_container>.vc_column-inner{padding-top:0;}@media (min-width:1440px) and (max-width:1679px){html{font-size:15px;}body{font-size:1em;}}@media (min-width:1263px) and (max-width:1439px){html{font-size:14px;}body{font-size:1em;}.content_wrap{width:1000px;}.menu_mobile .menu_mobile_nav_area li>a{font-size:1.2857em;line-height:1.5em;}.menu_mobile .menu_mobile_nav_area>ul>li>a{font-size:2em;line-height:1.5em;}}@media (min-width:1136px) and (max-width:1262px){.content_wrap{width:910px;}}@media (min-width:1024px) and (max-width:1135px){.content_wrap{width:964px;}}@media (min-width:960px) and (max-width:1023px){.content_wrap{width:900px;}.menu_main_nav>li>a{padding:1em 2em;}}@media (min-width:960px) and (max-width:1262px){html{font-size:13px;}body{font-size:1em;line-height:161.54%;letter-spacing:.5px;}html .content p{font-size:1.1rem;}h1{font-size:36px;line-height:42px;margin-top:36px;margin-bottom:20px;letter-spacing:2px;}h2{font-size:32px;line-height:38px;margin-top:42px;margin-bottom:24px;letter-spacing:3px;}p,ul{margin-bottom:1em;}.vc_row{margin-left:-15px;margin-right:-15px;}.vc_column_container>.vc_column-inner{padding-left:15px;padding-right:15px;}.menu_mobile .menu_mobile_nav_area li>a{font-size:1.2308em;line-height:1.5em;}.menu_mobile .menu_mobile_nav_area>ul>li>a{font-size:2em;line-height:1.5em;}}@media (min-width:768px) and (max-width:959px){html{font-size:13px;line-height:160%;}body{font-size:1em;line-height:161.54%;letter-spacing:.5px;}html .content p{font-size:1.1rem;}h1{font-size:32px;line-height:36px;margin-top:30px;margin-bottom:16px;letter-spacing:1px;}h2{font-size:28px;line-height:36px;margin-top:38px;margin-bottom:20px;letter-spacing:.5px;}p,ul{margin-bottom:1em;}.content_wrap{width:708px;}.vc_row{margin-left:-15px;margin-right:-15px;}.vc_column_container>.vc_column-inner{padding-left:15px;padding-right:15px;}.menu_mobile .menu_mobile_nav_area li>a{font-size:1.2308em;line-height:1.5em;}.menu_mobile .menu_mobile_nav_area>ul>li>a{font-size:2em;line-height:1.5em;}.top_panel{margin-bottom:6rem;}.header_fullwidth aside{width:100% !important;display:block !important;margin-left:0 !important;margin-bottom:0 !important;}}@media (min-width:640px) and (max-width:767px){.content_wrap{width:600px;}}@media (min-width:480px) and (max-width:639px){.content_wrap{width:440px;}}@media (min-width:480px) and (max-width:767px){html{font-size:13px;line-height:160%;}body{font-size:1em;line-height:161.54%;letter-spacing:.5px;}h1{font-size:28px;line-height:32px;margin-top:32px;margin-bottom:18px;letter-spacing:0px;}h2{font-size:26px;line-height:30px;margin-top:30px;margin-bottom:18px;letter-spacing:0px;}p,ul{margin-bottom:1em;}.menu_mobile .menu_mobile_nav_area li>a{font-size:1.2308em;line-height:1.5em;}.menu_mobile .menu_mobile_nav_area>ul>li>a{font-size:2em;line-height:1.5em;}.top_panel{margin-bottom:4rem;}.header_fullwidth aside{width:100% !important;display:block !important;margin-left:0 !important;margin-bottom:0 !important;}}@media (max-width:479px){html{font-size:13px;line-height:150%;}body{font-size:1em;line-height:153.85%;letter-spacing:.3px;}h1{font-size:28px;line-height:34px;margin-top:32px;margin-bottom:20px;letter-spacing:0px;}h2{font-size:24px;line-height:32px;margin-top:30px;margin-bottom:18px;letter-spacing:0px;}p,ul{margin-bottom:1em;}.content_wrap{width:300px;}.menu_mobile .menu_mobile_nav_area li>a{font-size:14px;line-height:1.5em;}.menu_mobile .menu_mobile_nav_area>ul>li>a{font-size:20px;line-height:1.5em;}.top_panel{margin-bottom:4rem;}.header_fullwidth aside{width:100% !important;display:block !important;margin-left:0 !important;margin-bottom:0 !important;}input[type="text"],input[type="tel"],select{padding:1em;}}@media (max-width:1439px){.menu_main_nav>li>a{padding-left:.7em;padding-right:.7em;}}@media (max-width:767px){.vc_row>.wpb_column.vc_col-sm-4+.wpb_column.vc_col-sm-4{padding-top:30px;}}@media (max-width:639px){.top_panel_top .content_wrap div{display:none;}}body.custom-background{background-color:#e0e2e3;}.vc_custom_1520503636019{background-position:center !important;background-repeat:no-repeat !important;background-size:cover !important;}</style><link rel="shortcut icon" href="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/themes/isida-child/favicon.ico" /> <link rel="profile" href="https://gmpg.org/xfn/11" /> <link rel="pingback" href="https://www.chirurgies-esthetique-entunisie.com/xmlrpc.php" /> <link rel="canonical" href="https://www.chirurgies-esthetique-entunisie.com/" /> <script type="application/ld+json" class="yoast-schema-graph">{"@context":"https:\/\/schema.org","@graph":[{"@type":"WebSite","@id":"https:\/\/www.chirurgies-esthetique-entunisie.com\/#website","url":"https:\/\/www.chirurgies-esthetique-entunisie.com\/","name":"Chirurgies esth\u00e9tique en Tunisie","description":"","potentialAction":[{"@type":"SearchAction","target":{"@type":"EntryPoint","urlTemplate":"https:\/\/www.chirurgies-esthetique-entunisie.com\/?s={search_term_string}"},"query-input":"required name=search_term_string"}],"inLanguage":"fr-FR"},{"@type":"ImageObject","inLanguage":"fr-FR","@id":"https:\/\/www.chirurgies-esthetique-entunisie.com\/#primaryimage","url":"https:\/\/www.chirurgies-esthetique-entunisie.com\/wp-content\/uploads\/2022\/06\/290292777_5089201531134059_2674232276719326447_n.jpg","contentUrl":"https:\/\/www.chirurgies-esthetique-entunisie.com\/wp-content\/uploads\/2022\/06\/290292777_5089201531134059_2674232276719326447_n.jpg","width":1651,"height":728,"caption":"la chirugie esthetique en Tunisie"},{"@type":"WebPage","@id":"https:\/\/www.chirurgies-esthetique-entunisie.com\/","url":"https:\/\/www.chirurgies-esthetique-entunisie.com\/","name":"Chirurgie Esthetique Tunisie \u21d2 meilleure agence, prix, chirurgien","isPartOf":{"@id":"https:\/\/www.chirurgies-esthetique-entunisie.com\/#website"},"primaryImageOfPage":{"@id":"https:\/\/www.chirurgies-esthetique-entunisie.com\/#primaryimage"},"image":{"@id":"https:\/\/www.chirurgies-esthetique-entunisie.com\/#primaryimage"},"thumbnailUrl":"https:\/\/www.chirurgies-esthetique-entunisie.com\/wp-content\/uploads\/2022\/06\/290292777_5089201531134059_2674232276719326447_n-1024x452.jpg","datePublished":"2016-10-20T09:44:53+00:00","dateModified":"2022-07-20T15:06:46+00:00","description":"Chirurgie Esthetique Tunisie \u00e0 Tarifs Exceptionnels \u2764 \u2705 S\u00e9jour Tout Compris \u00e0 prix pas cher\ud83d\udcb2meilleur chirurgien \ud83d\udc68\u200d clinique \ud83c\udfe5 agence","breadcrumb":{"@id":"https:\/\/www.chirurgies-esthetique-entunisie.com\/#breadcrumb"},"inLanguage":"fr-FR","potentialAction":[{"@type":"ReadAction","target":["https:\/\/www.chirurgies-esthetique-entunisie.com\/"]}]},{"@type":"BreadcrumbList","@id":"https:\/\/www.chirurgies-esthetique-entunisie.com\/#breadcrumb","itemListElement":[{"@type":"ListItem","position":1,"name":"Accueil"}]}]}</script> <template data-nitro-marker-id="007bdc004a584be6cec2e166c680e2c5-1"></template> <link rel='dns-prefetch' href='//fonts.googleapis.com' /> <link rel='dns-prefetch' href='//s.w.org' /> <link rel="alternate" type="application/rss+xml" title="Chirurgies esthétique en Tunisie &raquo; Flux" href="https://www.chirurgies-esthetique-entunisie.com/feed/" /> <link rel="alternate" type="application/rss+xml" title="Chirurgies esthétique en Tunisie &raquo; Flux des commentaires" href="https://www.chirurgies-esthetique-entunisie.com/comments/feed/" /> <template data-nitro-marker-id="e0180dfbd485b47e191020c018e0dfb3-1"></template> <template data-nitro-marker-id="jquery-core-js"></template> <template data-nitro-marker-id="jquery-migrate-js"></template> <template data-nitro-marker-id="jquery-ui-core-js"></template> <template data-nitro-marker-id="cwp-main-js"></template> <template data-nitro-marker-id="Total_Soft_Gallery_Video-js-extra"></template> <template data-nitro-marker-id="Total_Soft_Gallery_Video-js"></template> <template data-nitro-marker-id="wp-odoo-form-integrator-js"></template> <template data-nitro-marker-id="pys_sp_public_js-js"></template> <template data-nitro-marker-id="js-cookie-js"></template> <template data-nitro-marker-id="jquery-bind-first-js"></template> <template data-nitro-marker-id="vimeo-js"></template> <template data-nitro-marker-id="pys-js-extra"></template> <template data-nitro-marker-id="pys-js"></template> <link rel="https://api.w.org/" href="https://www.chirurgies-esthetique-entunisie.com/wp-json/" /><link rel="alternate" type="application/json" href="https://www.chirurgies-esthetique-entunisie.com/wp-json/wp/v2/pages/319" /><link rel="EditURI" type="application/rsd+xml" title="RSD" href="https://www.chirurgies-esthetique-entunisie.com/xmlrpc.php?rsd" /> <link rel="wlwmanifest" type="application/wlwmanifest+xml" href="https://www.chirurgies-esthetique-entunisie.com/wp-includes/wlwmanifest.xml" /> <link rel='shortlink' href='https://www.chirurgies-esthetique-entunisie.com/' /> <link rel="alternate" type="application/json+oembed" href="https://www.chirurgies-esthetique-entunisie.com/wp-json/oembed/1.0/embed?url=https%3A%2F%2Fwww.chirurgies-esthetique-entunisie.com%2F" /> <link rel="alternate" type="text/xml+oembed" href="https://www.chirurgies-esthetique-entunisie.com/wp-json/oembed/1.0/embed?url=https%3A%2F%2Fwww.chirurgies-esthetique-entunisie.com%2F&#038;format=xml" /> <link rel="icon" sizes="32x32" href="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/04/cropped-logo-chirurgie-2-32x32.png" /> <link rel="icon" sizes="192x192" href="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/04/cropped-logo-chirurgie-2-192x192.png" /> <link rel="apple-touch-icon" href="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/04/cropped-logo-chirurgie-2-180x180.png" /> <noscript><style type="text/css"> .wpb_animate_when_almost_visible { opacity: 1; }</style></noscript> <template data-nitro-marker-id="cceb1fa34f70c378b8382e286f90a44d-1"></template> <template data-nitro-marker-id="a073bd1a6ae4babf61a3ecbf0db0a14d-1"></template> <template data-nitro-marker-id="74fb6f3bb3222fe37a8f8b9535b9bf52-1"></template><script nitro-exclude>window.IS_NITROPACK=!0;window.NITROPACK_STATE='FRESH';</script><style nitro-exclude>body>div.preloader,body>div#preloader,body>div#page-preloader.visible,body>div#loader-wrapper{display:none !important;}body>div.l-preloader{opacity:0 !important;}</style><style>@media only screen and (max-width: 767px) {
    .rev_slider_wrapper.fullwidthbanner-container {
        height: 264px;
    }
}
@media only screen and (min-width: 768px) {
    .rev_slider_wrapper.fullwidthbanner-container {
        height: 500px;
    }
}
@media only screen and (min-width: 1024px) {
    .rev_slider_wrapper.fullwidthbanner-container {
        height: 600px;
    }
}
@media only screen and (min-width: 1240px) {
    .rev_slider_wrapper.fullwidthbanner-container {
        height: 767px;
    }
}
</style><script>window.nitro_lazySizesConfig=window.nitro_lazySizesConfig||{};window.nitro_lazySizesConfig.lazyClass="nitro-lazy";nitro_lazySizesConfig.srcAttr="nitro-lazy-src";nitro_lazySizesConfig.srcsetAttr="nitro-lazy-srcset";nitro_lazySizesConfig.expand=10;nitro_lazySizesConfig.expFactor=1;nitro_lazySizesConfig.hFac=1;nitro_lazySizesConfig.loadMode=1;nitro_lazySizesConfig.ricTimeout=50;nitro_lazySizesConfig.loadHidden=true;(function(){var e=null;var a=false;var t=false;var i={childList:false,attributes:true,subtree:false,attributeFilter:["src"],attributeOldValue:true};var r=null;var n=[];function o(e){let t=n.indexOf(e);if(t>-1){n.splice(t,1);r.disconnect();c()}e.contentWindow.location.replace(e.getAttribute("nitro-og-src"))}function l(){if(!r){r=new MutationObserver(function(e,a){e.forEach(n=>{if(n.type=="attributes"&&n.attributeName=="src"){let t=n.target;let i=t.getAttribute("nitro-og-src");let r=t.src;if(r!=i){a.disconnect();let e=r.replace(n.oldValue,"");if(r.indexOf("data:")===0&&["?","&"].indexOf(e.substr(0,1))>-1){if(i.indexOf("?")>-1){t.setAttribute("nitro-og-src",i+"&"+e.substr(1))}else{t.setAttribute("nitro-og-src",i+"?"+e.substr(1))}}t.src=n.oldValue;c()}}})})}return r}function s(e){l().observe(e,i)}function c(){n.forEach(s)}function u(){window.removeEventListener("scroll",u);window.nitro_lazySizesConfig.expand=300}window.addEventListener("scroll",u,{passive:true});window.addEventListener("NitroStylesLoaded",function(){a=true});window.addEventListener("load",function(){t=true});window.addEventListener("message",function(e){if(e.data.action&&e.data.action==="playBtnClicked"){var t=document.getElementsByTagName("iframe");for(var i=0;i<t.length;i++){if(e.source===t[i].contentWindow){o(t[i])}}}});document.addEventListener("lazybeforeunveil",function(t){var i=false;var r=t.target.getAttribute("nitro-lazy-bg");if(r){let e=t.target.style.backgroundImage.replace("data:image/gif;base64,R0lGODlhAQABAIABAAAAAP///yH5BAEAAAEALAAAAAABAAEAAAICTAEAOw==",r.replace(/\(/g,"%28").replace(/\)/g,"%29"));if(e===t.target.style.backgroundImage){e="url("+r.replace(/\(/g,"%28").replace(/\)/g,"%29")+")"}t.target.style.backgroundImage=e;i=true}var e=t.target.className.indexOf("elementor-invisible")!=-1;if(e){i=true;if(a){t.target.className=t.target.className.replace("elementor-invisible","")}else{window.addEventListener("NitroStylesLoaded",function(e){return function(){e.className=e.className.replace("elementor-invisible","")}}(t.target))}}if(!i){var n=t.target.tagName.toLowerCase();if(n!=="img"&&n!=="iframe"){t.target.querySelectorAll("img[nitro-lazy-src],img[nitro-lazy-srcset]").forEach(function(e){e.classList.add("nitro-lazy")})}}});document.addEventListener("DOMContentLoaded",function(){document.querySelectorAll("iframe[nitro-og-src]").forEach(t=>{if(t.getAttribute("nitro-og-src").indexOf("vimeo")>-1){t.realGetAttribute=t.getAttribute;Object.defineProperty(t,"src",{value:t.getAttribute("nitro-og-src"),writable:false});Object.defineProperty(t,"getAttribute",{value:function(e){if(e=="src"){return t.realGetAttribute("nitro-og-src")}else{return t.realGetAttribute(e)}},writable:false})}n.push(t)});c()})})();</script><script id="nitro-lazyloader">/*! lazysizes - v5.1.2 */
!function(a,b){var c=b(a,a.document);a.lazySizes=c,"object"==typeof module&&module.exports&&(module.exports=c)}("undefined"!=typeof window?window:{},function(a,b){"use strict";var c,d;if(function(){var b,c={lazyClass:"lazyload",loadedClass:"lazyloaded",loadingClass:"lazyloading",preloadClass:"lazypreload",errorClass:"lazyerror",autosizesClass:"lazyautosizes",srcAttr:"data-src",srcsetAttr:"data-srcset",sizesAttr:"data-sizes",minSize:40,customMedia:{},init:!0,expFactor:1.5,hFac:.8,loadMode:2,loadHidden:!0,ricTimeout:0,throttleDelay:125};d=a.nitro_lazySizesConfig||a.nitro_lazysizesConfig||{};for(b in c)b in d||(d[b]=c[b])}(),!b||!b.getElementsByClassName)return{init:function(){},cfg:d,noSupport:!0};var e=b.documentElement,f=a.Date,g=a.HTMLPictureElement,h="addEventListener",i="getAttribute",j=a[h],k=a.setTimeout,l=a.requestAnimationFrame||k,m=a.requestIdleCallback,n=/^picture$/i,o=["load","error","lazyincluded","_lazyloaded"],p={},q=Array.prototype.forEach,r=function(a,b){return p[b]||(p[b]=new RegExp("(\\s|^)"+b+"(\\s|$)")),p[b].test(a[i]("class")||"")&&p[b]},s=function(a,b){r(a,b)||a.setAttribute("class",(a[i]("class")||"").trim()+" "+b)},t=function(a,b){var c;(c=r(a,b))&&a.setAttribute("class",(a[i]("class")||"").replace(c," "))},u=function(a,b,c){var d=c?h:"removeEventListener";c&&u(a,b),o.forEach(function(c){a[d](c,b)})},v=function(a,d,e,f,g){var h=b.createEvent("Event");return e||(e={}),e.instance=c,h.initEvent(d,!f,!g),h.detail=e,a.dispatchEvent(h),h},w=function(b,c){var e;!g&&(e=a.picturefill||d.pf)?(c&&c.src&&!b[i]("srcset")&&b.setAttribute("srcset",c.src),e({reevaluate:!0,elements:[b]})):c&&c.src&&(b.src=c.src)},x=function(a,b){return(getComputedStyle(a,null)||{})[b]},y=function(a,b,c){for(c=c||a.offsetWidth;c<d.minSize&&b&&!a._lazysizesWidth;)c=b.offsetWidth,b=b.parentNode;return c},z=function(){var a,c,d=[],e=[],f=d,g=function(){var b=f;for(f=d.length?e:d,a=!0,c=!1;b.length;)b.shift()();a=!1},h=function(d,e){a&&!e?d.apply(this,arguments):(f.push(d),c||(c=!0,(b.hidden?k:l)(g)))};return h._lsFlush=g,h}(),A=function(a,b){return b?function(){z(a)}:function(){var b=this,c=arguments;z(function(){a.apply(b,c)})}},B=function(a){var b,c=0,e=d.throttleDelay,g=d.ricTimeout,h=function(){b=!1,c=f.now(),a()},i=m&&g>49?function(){m(h,{timeout:g}),g!==d.ricTimeout&&(g=d.ricTimeout)}:A(function(){k(h)},!0);return function(a){var d;(a=!0===a)&&(g=33),b||(b=!0,d=e-(f.now()-c),d<0&&(d=0),a||d<9?i():k(i,d))}},C=function(a){var b,c,d=99,e=function(){b=null,a()},g=function(){var a=f.now()-c;a<d?k(g,d-a):(m||e)(e)};return function(){c=f.now(),b||(b=k(g,d))}},D=function(){var g,l,m,o,p,y,D,F,G,H,I,J,K=/^img$/i,L=/^iframe$/i,M="onscroll"in a&&!/(gle|ing)bot/.test(navigator.userAgent),N=0,O=0,P=0,Q=-1,R=function(a){P--,(!a||P<0||!a.target)&&(P=0)},S=function(a){return null==J&&(J="hidden"==x(b.body,"visibility")),J||!("hidden"==x(a.parentNode,"visibility")&&"hidden"==x(a,"visibility"))},T=function(a,c){var d,f=a,g=S(a);for(F-=c,I+=c,G-=c,H+=c;g&&(f=f.offsetParent)&&f!=b.body&&f!=e;)(g=(x(f,"opacity")||1)>0)&&"visible"!=x(f,"overflow")&&(d=f.getBoundingClientRect(),g=H>d.left&&G<d.right&&I>d.top-1&&F<d.bottom+1);return g},U=function(){var a,f,h,j,k,m,n,p,q,r,s,t,u=c.elements;if((o=d.loadMode)&&P<8&&(a=u.length)){for(f=0,Q++;f<a;f++)if(u[f]&&!u[f]._lazyRace)if(!M||c.prematureUnveil&&c.prematureUnveil(u[f]))aa(u[f]);else if((p=u[f][i]("data-expand"))&&(m=1*p)||(m=O),r||(r=!d.expand||d.expand<1?e.clientHeight>500&&e.clientWidth>500?500:370:d.expand,c._defEx=r,s=r*d.expFactor,t=d.hFac,J=null,O<s&&P<1&&Q>2&&o>2&&!b.hidden?(O=s,Q=0):O=o>1&&Q>1&&P<6?r:N),q!==m&&(y=innerWidth+m*t,D=innerHeight+m,n=-1*m,q=m),h=u[f].getBoundingClientRect(),(I=h.bottom)>=n&&(F=h.top)<=D&&(H=h.right)>=n*t&&(G=h.left)<=y&&(I||H||G||F)&&(d.loadHidden||S(u[f]))&&(l&&P<3&&!p&&(o<3||Q<4)||T(u[f],m))){if(aa(u[f]),k=!0,P>9)break}else!k&&l&&!j&&P<4&&Q<4&&o>2&&(g[0]||d.preloadAfterLoad)&&(g[0]||!p&&(I||H||G||F||"auto"!=u[f][i](d.sizesAttr)))&&(j=g[0]||u[f]);j&&!k&&aa(j)}},V=B(U),W=function(a){var b=a.target;if(b._lazyCache)return void delete b._lazyCache;R(a),s(b,d.loadedClass),t(b,d.loadingClass),u(b,Y),v(b,"lazyloaded")},X=A(W),Y=function(a){X({target:a.target})},Z=function(a,b){try{a.contentWindow.location.replace(b)}catch(c){a.src=b}},$=function(a){var b,c=a[i](d.srcsetAttr);(b=d.customMedia[a[i]("data-media")||a[i]("media")])&&a.setAttribute("media",b),c&&a.setAttribute("srcset",c)},_=A(function(a,b,c,e,f){var g,h,j,l,o,p;(o=v(a,"lazybeforeunveil",b)).defaultPrevented||(e&&(c?s(a,d.autosizesClass):a.setAttribute("sizes",e)),h=a[i](d.srcsetAttr),g=a[i](d.srcAttr),f&&(j=a.parentNode,l=j&&n.test(j.nodeName||"")),p=b.firesLoad||"src"in a&&(h||g||l),o={target:a},s(a,d.loadingClass),p&&(clearTimeout(m),m=k(R,2500),u(a,Y,!0)),l&&q.call(j.getElementsByTagName("source"),$),h?a.setAttribute("srcset",h):g&&!l&&(L.test(a.nodeName)?Z(a,g):a.src=g),f&&(h||l)&&w(a,{src:g})),a._lazyRace&&delete a._lazyRace,t(a,d.lazyClass),z(function(){var b=a.complete&&a.naturalWidth>1;p&&!b||(b&&s(a,"ls-is-cached"),W(o),a._lazyCache=!0,k(function(){"_lazyCache"in a&&delete a._lazyCache},9)),"lazy"==a.loading&&P--},!0)}),aa=function(a){if(!a._lazyRace){var b,c=K.test(a.nodeName),e=c&&(a[i](d.sizesAttr)||a[i]("sizes")),f="auto"==e;(!f&&l||!c||!a[i]("src")&&!a.srcset||a.complete||r(a,d.errorClass)||!r(a,d.lazyClass))&&(b=v(a,"lazyunveilread").detail,f&&E.updateElem(a,!0,a.offsetWidth),a._lazyRace=!0,P++,_(a,b,f,e,c))}},ba=C(function(){d.loadMode=3,V()}),ca=function(){3==d.loadMode&&(d.loadMode=2),ba()},da=function(){if(!l){if(f.now()-p<999)return void k(da,999);l=!0,d.loadMode=3,V(),j("scroll",ca,!0)}};return{_:function(){p=f.now(),c.elements=b.getElementsByClassName(d.lazyClass),g=b.getElementsByClassName(d.lazyClass+" "+d.preloadClass),j("scroll",V,!0),j("resize",V,!0),a.MutationObserver?new MutationObserver(V).observe(e,{childList:!0,subtree:!0,attributes:!0}):(e[h]("DOMNodeInserted",V,!0),e[h]("DOMAttrModified",V,!0),setInterval(V,999)),j("hashchange",V,!0),["focus","mouseover","click","load","transitionend","animationend"].forEach(function(a){b[h](a,V,!0)}),/d$|^c/.test(b.readyState)?da():(j("load",da),b[h]("DOMContentLoaded",V),k(da,2e4)),c.elements.length?(U(),z._lsFlush()):V()},checkElems:V,unveil:aa,_aLSL:ca}}(),E=function(){var a,c=A(function(a,b,c,d){var e,f,g;if(a._lazysizesWidth=d,d+="px",a.setAttribute("sizes",d),n.test(b.nodeName||""))for(e=b.getElementsByTagName("source"),f=0,g=e.length;f<g;f++)e[f].setAttribute("sizes",d);c.detail.dataAttr||w(a,c.detail)}),e=function(a,b,d){var e,f=a.parentNode;f&&(d=y(a,f,d),e=v(a,"lazybeforesizes",{width:d,dataAttr:!!b}),e.defaultPrevented||(d=e.detail.width)&&d!==a._lazysizesWidth&&c(a,f,e,d))},f=function(){var b,c=a.length;if(c)for(b=0;b<c;b++)e(a[b])},g=C(f);return{_:function(){a=b.getElementsByClassName(d.autosizesClass),j("resize",g)},checkElems:g,updateElem:e}}(),F=function(){!F.i&&b.getElementsByClassName&&(F.i=!0,E._(),D._())};return k(function(){d.init&&F()}),c={cfg:d,autoSizer:E,loader:D,init:F,uP:w,aC:s,rC:t,hC:r,fire:v,gW:y,rAF:z}});</script><script id="007bdc004a584be6cec2e166c680e2c5-1" type="nitropack/inlinescript" class="nitropack-inline-script">console.log('PixelYourSite PRO version 9.2.0');</script><script id="e0180dfbd485b47e191020c018e0dfb3-1" type="nitropack/inlinescript" class="nitropack-inline-script">
window._wpemojiSettings = {"baseUrl":"https:\/\/s.w.org\/images\/core\/emoji\/14.0.0\/72x72\/","ext":".png","svgUrl":"https:\/\/s.w.org\/images\/core\/emoji\/14.0.0\/svg\/","svgExt":".svg","source":{"concatemoji":"https:\/\/www.chirurgies-esthetique-entunisie.com\/wp-includes\/js\/wp-emoji-release.min.js?ver=6.0.1"}};
/*! This file is auto-generated */
!function(e,a,t){var n,r,o,i=a.createElement("canvas"),p=i.getContext&&i.getContext("2d");function s(e,t){var a=String.fromCharCode,e=(p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,e),0,0),i.toDataURL());return p.clearRect(0,0,i.width,i.height),p.fillText(a.apply(this,t),0,0),e===i.toDataURL()}function c(e){var t=a.createElement("script");t.src=e,t.defer=t.type="text/javascript",a.getElementsByTagName("head")[0].appendChild(t)}for(o=Array("flag","emoji"),t.supports={everything:!0,everythingExceptFlag:!0},r=0;r<o.length;r++)t.supports[o[r]]=function(e){if(!p||!p.fillText)return!1;switch(p.textBaseline="top",p.font="600 32px Arial",e){case"flag":return s([127987,65039,8205,9895,65039],[127987,65039,8203,9895,65039])?!1:!s([55356,56826,55356,56819],[55356,56826,8203,55356,56819])&&!s([55356,57332,56128,56423,56128,56418,56128,56421,56128,56430,56128,56423,56128,56447],[55356,57332,8203,56128,56423,8203,56128,56418,8203,56128,56421,8203,56128,56430,8203,56128,56423,8203,56128,56447]);case"emoji":return!s([129777,127995,8205,129778,127999],[129777,127995,8203,129778,127999])}return!1}(o[r]),t.supports.everything=t.supports.everything&&t.supports[o[r]],"flag"!==o[r]&&(t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&t.supports[o[r]]);t.supports.everythingExceptFlag=t.supports.everythingExceptFlag&&!t.supports.flag,t.DOMReady=!1,t.readyCallback=function(){t.DOMReady=!0},t.supports.everything||(n=function(){t.readyCallback()},a.addEventListener?(a.addEventListener("DOMContentLoaded",n,!1),e.addEventListener("load",n,!1)):(e.attachEvent("onload",n),a.attachEvent("onreadystatechange",function(){"complete"===a.readyState&&t.readyCallback()})),(e=t.source||{}).concatemoji?c(e.concatemoji):e.wpemoji&&e.twemoji&&(c(e.twemoji),c(e.wpemoji)))}(window,document,window._wpemojiSettings);
</script><script id="Total_Soft_Gallery_Video-js-extra" type="nitropack/inlinescript" class="nitropack-inline-script">
/* <![CDATA[ */
var object = {"ajaxurl":"https:\/\/www.chirurgies-esthetique-entunisie.com\/wp-admin\/admin-ajax.php"};
/* ]]> */
</script><script id="pys-js-extra" type="nitropack/inlinescript" class="nitropack-inline-script">
/* <![CDATA[ */
var pysOptions = {"staticEvents":{"facebook":{"init_event":[{"delay":0,"type":"static","name":"PageView","eventID":"cc75fbce-928e-4128-9974-92324329d3bd","pixelIds":["373716691486944"],"params":{"page_title":"Accueil","post_type":"page","post_id":319,"plugin":"PixelYourSite","event_url":"www.chirurgies-esthetique-entunisie.com\/","user_role":"guest"},"e_id":"init_event","ids":[],"hasTimeWindow":false,"timeWindow":0,"woo_order":"","edd_order":""}]}},"dynamicEvents":[],"triggerEvents":[],"triggerEventTypes":[],"facebook":{"pixelIds":["373716691486944"],"advancedMatching":[],"removeMetadata":false,"wooVariableAsSimple":false,"serverApiEnabled":true,"ajaxForServerEvent":true,"wooCRSendFromServer":false,"send_external_id":true},"ga":{"trackingIds":["UA-226989390-1"],"enhanceLinkAttr":false,"anonimizeIP":false,"retargetingLogic":"ecomm","crossDomainEnabled":false,"crossDomainAcceptIncoming":false,"crossDomainDomains":[],"wooVariableAsSimple":false,"isDebugEnabled":[],"disableAdvertisingFeatures":false,"disableAdvertisingPersonalization":false},"debug":"1","siteUrl":"https:\/\/www.chirurgies-esthetique-entunisie.com","ajaxUrl":"https:\/\/www.chirurgies-esthetique-entunisie.com\/wp-admin\/admin-ajax.php","trackUTMs":"1","trackTrafficSource":"1","user_id":"0","enable_lading_page_param":"1","cookie_duration":"7","enable_event_day_param":"1","enable_event_month_param":"1","enable_event_time_param":"1","enable_remove_target_url_param":"1","enable_remove_download_url_param":"1","visit_data_model":"first_visit","gdpr":{"ajax_enabled":false,"all_disabled_by_api":false,"facebook_disabled_by_api":false,"tiktok_disabled_by_api":false,"analytics_disabled_by_api":false,"google_ads_disabled_by_api":false,"pinterest_disabled_by_api":false,"bing_disabled_by_api":false,"facebook_prior_consent_enabled":false,"tiktok_prior_consent_enabled":true,"analytics_prior_consent_enabled":true,"google_ads_prior_consent_enabled":true,"pinterest_prior_consent_enabled":true,"bing_prior_consent_enabled":true,"cookiebot_integration_enabled":false,"cookiebot_facebook_consent_category":"marketing","cookiebot_analytics_consent_category":"statistics","cookiebot_google_ads_consent_category":"marketing","cookiebot_pinterest_consent_category":"marketing","cookiebot_bing_consent_category":"marketing","cookie_notice_integration_enabled":false,"cookie_law_info_integration_enabled":false,"real_cookie_banner_integration_enabled":false,"consent_magic_integration_enabled":false},"automatic":{"enable_youtube":true,"enable_vimeo":true,"enable_video":true},"woo":{"enabled":false},"edd":{"enabled":false}};
/* ]]> */
</script><script id="cceb1fa34f70c378b8382e286f90a44d-1" type="nitropack/inlinescript" class="nitropack-inline-script">(function(w,d,s,l,i){w[l]=w[l]||[];w[l].push({'gtm.start':
new Date().getTime(),event:'gtm.js'});var f=d.getElementsByTagName(s)[0],
j=d.createElement(s),dl=l!='dataLayer'?'&l='+l:'';j.async=true;j.src=
'https://www.googletagmanager.com/gtm.js?id='+i+dl;f.parentNode.insertBefore(j,f);
})(window,document,'script','dataLayer','GTM-5DFNXDW');
	</script><script id="a073bd1a6ae4babf61a3ecbf0db0a14d-1" type="nitropack/inlinescript" class="nitropack-inline-script">var getUrlParameter=function e(a){var i=decodeURIComponent(window.location.search.substring(1)),d=i.split("&"),n,o;for(o=0;o<d.length;o++){n=d[o].split("=");if(n[0]===a){return n[1]===undefined?true:n[1]}}};function setCookie(e,a,i){const d=new Date;d.setTime(d.getTime()+i*24*60*60*1e3);let n="expires="+d.toUTCString();document.cookie=e+"="+a+";"+n+";path=/"}var UrlVar1=getUrlParameter("fbclid");if(UrlVar1=="undefined"||UrlVar1==""||UrlVar1==null){}else{document.cookie="fbclid="+UrlVar1+";path=/"}if(Cookies.get("fbclid")==null||Cookies.get("fbclid")==""||Cookies.get("fbclid")=="undefined"){Cookies.set("fbclid","")}var campaign_id=getUrlParameter("campaign_id");if(campaign_id=="undefined"||campaign_id==""||campaign_id==null){}else{document.cookie="campaign_id="+campaign_id+";path=/"}if(Cookies.get("campaign_id")==null||Cookies.get("campaign_id")==""||Cookies.get("campaign_id")=="undefined"){Cookies.set("campaign_id","")}var ad_id=getUrlParameter("ad_id");if(ad_id=="undefined"||ad_id==""||ad_id==null){}else{document.cookie="ad_id="+ad_id+";path=/"}if(Cookies.get("ad_id")==null||Cookies.get("ad_id")==""||Cookies.get("ad_id")=="undefined"){Cookies.set("ad_id","")}var adset_name=getUrlParameter("adset_name");if(adset_name=="undefined"||adset_name==""||adset_name==null){}else{document.cookie="adset_name="+adset_name+";path=/"}if(Cookies.get("adset_name")==null||Cookies.get("adset_name")==""||Cookies.get("adset_name")=="undefined"){Cookies.set("adset_name","")}var ad_name=getUrlParameter("ad_name");if(ad_name=="undefined"||ad_name==""||ad_name==null){}else{document.cookie="ad_name="+ad_name+";path=/"}if(Cookies.get("ad_name")==null||Cookies.get("ad_name")==""||Cookies.get("ad_name")=="undefined"){Cookies.set("ad_name","")}function jqurlcookies(){document.getElementById("GetParamFromUrl1").value=Cookies.get("campaign_id");document.getElementById("GetParamFromUrl2").value=Cookies.get("ad_id");document.getElementById("GetParamFromUrl3").value=Cookies.get("adset_name");document.getElementById("GetParamFromUrl4").value=Cookies.get("ad_name")}window.onload=jqurlcookies;</script><script id="74fb6f3bb3222fe37a8f8b9535b9bf52-1" type="nitropack/inlinescript" class="nitropack-inline-script">document.addEventListener("wpcf7mailsent",function(t){if("776"==t.detail.contactFormId){location="https://www.chirurgies-esthetique-entunisie.com/devis-confirmation/"}else{location="https://www.chirurgies-esthetique-entunisie.com/contact-confirmation/"}},false);</script><script id="e51f213f7e024ee6b30f4932a6f6d9ae-1" type="nitropack/inlinescript" class="nitropack-inline-script">
/* <![CDATA[ */
var google_conversion_id = 807194730;
var google_custom_params = window.google_tag_params;
var google_remarketing_only = true;
/* ]]> */
</script><script id="f99b89b4647fb366ec1e3f2595305b9b-1" type="nitropack/inlinescript" class="nitropack-inline-script">var widgetIds=[];var cf7srLoadCallback=function(){var e=document.querySelectorAll(".cf7sr-g-recaptcha");for(var a=0;a<e.length;++a){var r=e[a];var c=grecaptcha.render(r.id,{sitekey:"6LdufogfAAAAAI4JR09dTWx8o4SHmN12lT55aMf9"});widgetIds.push(c)}};(function(e){e(".wpcf7").on("wpcf7invalid wpcf7mailsent invalid.wpcf7 mailsent.wpcf7",function(){for(var e=0;e<widgetIds.length;e++){grecaptcha.reset(widgetIds[e])}})})(jQuery);</script><script id="ce0e37ba6dd35f3848785cc7d29fa29d-1" type="nitropack/inlinescript" class="nitropack-inline-script">jQuery(document).ready(function(){setTimeout(function(){jQuery.post(TRX_ADDONS_STORAGE["ajax_url"],{action:"post_counter",nonce:TRX_ADDONS_STORAGE["ajax_nonce"],post_id:319,views:1}).done(function(e){var r={};try{r=JSON.parse(e)}catch(o){r={error:TRX_ADDONS_STORAGE["ajax_error"]};console.log(e)}if(r.error===""){jQuery(".post_counters_single .post_counters_views .post_counters_number").html(r.counter)}})},10)});</script><script id="contact-form-7-js-extra" type="nitropack/inlinescript" class="nitropack-inline-script">
/* <![CDATA[ */
var wpcf7 = {"api":{"root":"https:\/\/www.chirurgies-esthetique-entunisie.com\/wp-json\/","namespace":"contact-form-7\/v1"},"cached":"1"};
/* ]]> */
</script><script id="nbcpf-countryFlag-script-js-after" type="nitropack/inlinescript" class="nitropack-inline-script">(function(t){t(function(){jQuery.ajax({url:"//freegeoip.live/json/",type:"POST",dataType:"jsonp",success:function(e){t(".wpcf7-countrytext").countrySelect({defaultCountry:e.country_code.toLowerCase(),preferredCountries:["Fr","Be"]});t(".wpcf7-phonetext").intlTelInput({autoHideDialCode:false,autoPlaceholder:"off",nationalMode:true,separateDialCode:false,hiddenInput:"full_number",initialCountry:e.country_code.toLowerCase(),preferredCountries:["Fr","Be"]});t(".wpcf7-phonetext").each(function(){var e=t(this).attr("name");t("input[name="+e+"-country-code]").val(t(this).val())});t(".wpcf7-phonetext").on("countrychange",function(){var e=t(this).attr("name");t("input[name="+e+"-country-code]").val(this.value)})}})})})(jQuery);</script><script id="trx_addons-js-extra" type="nitropack/inlinescript" class="nitropack-inline-script">
/* <![CDATA[ */
var TRX_ADDONS_STORAGE = {"ajax_url":"https:\/\/www.chirurgies-esthetique-entunisie.com\/wp-admin\/admin-ajax.php","ajax_nonce":"3efc17869d","site_url":"https:\/\/www.chirurgies-esthetique-entunisie.com","vc_edit_mode":"0","popup_engine":"magnific","menu_cache":[],"user_logged_in":"0","email_mask":"^([a-zA-Z0-9_\\-]+\\.)*[a-zA-Z0-9_\\-]+@[a-z0-9_\\-]+(\\.[a-z0-9_\\-]+)*\\.[a-z]{2,6}$","msg_ajax_error":"Invalid server answer!","msg_magnific_loading":"Loading image","msg_magnific_error":"Error loading image","msg_error_like":"Error saving your like! Please, try again later.","msg_field_name_empty":"The name can't be empty","msg_field_phone_empty":"The phone can't be empty","msg_field_email_empty":"Too short (or empty) email address","msg_field_email_not_valid":"Invalid email address","msg_field_text_empty":"The message text can't be empty","msg_send_complete":"Send message complete!","msg_send_error":"Transmit failed!","login_via_ajax":"1","msg_login_empty":"The Login field can't be empty","msg_login_long":"The Login field is too long","msg_password_empty":"The password can't be empty and shorter then 4 characters","msg_password_long":"The password is too long","msg_login_success":"Login success! The page should be reloaded in 3 sec.","msg_login_error":"Login failed!","msg_not_agree":"Please, read and check 'Terms and Conditions'","msg_email_long":"E-mail address is too long","msg_email_not_valid":"E-mail address is invalid","msg_password_not_equal":"The passwords in both fields are not equal","msg_registration_success":"Registration success! Please log in!","msg_registration_error":"Registration failed!","scroll_to_anchor":"1","update_location_from_anchor":"0","msg_sc_googlemap_not_avail":"Googlemap service is not available","msg_sc_googlemap_geocoder_error":"Error while geocode address"};
/* ]]> */
</script><script id="isida-init-js-extra" type="nitropack/inlinescript" class="nitropack-inline-script">
/* <![CDATA[ */
var ISIDA_STORAGE = {"ajax_url":"https:\/\/www.chirurgies-esthetique-entunisie.com\/wp-admin\/admin-ajax.php","ajax_nonce":"3efc17869d","site_url":"https:\/\/www.chirurgies-esthetique-entunisie.com","user_logged_in":"","mobile_layout_width":"1262","menu_stretch":"1","menu_animation_in":"fadeInUpSmall","menu_animation_out":"fadeOutDownSmall","background_video":"","use_mediaelements":"1","message_maxlength":"1000","site_scheme":"scheme_default","admin_mode":"","email_mask":"^([a-zA-Z0-9_\\-]+\\.)*[a-zA-Z0-9_\\-]+@[a-z0-9_\\-]+(\\.[a-z0-9_\\-]+)*\\.[a-z]{2,6}$","strings":{"ajax_error":"Invalid server answer!","error_global":"Error data validation!","name_empty":"The name can&#039;t be empty","name_long":"Too long name","email_empty":"Too short (or empty) email address","email_long":"Too long email address","email_not_valid":"Invalid email address","text_empty":"The message text can&#039;t be empty","text_long":"Too long message text","search_error":"Search error! Try again later.","send_complete":"Send message complete!","send_error":"Transmit failed!"},"menu_hover":"fade","menu_hover_color":"#ff6867","button_hover":"slide_left","alter_link_color":"#3e78c4"};
/* ]]> */
</script><script id="mediaelement-core-js-before" type="nitropack/inlinescript" class="nitropack-inline-script">
var mejsL10n = {"language":"fr","strings":{"mejs.download-file":"T\u00e9l\u00e9charger le fichier","mejs.install-flash":"Vous utilisez un navigateur qui n\u2019a pas le lecteur Flash activ\u00e9 ou install\u00e9. Veuillez activer votre extension Flash ou t\u00e9l\u00e9charger la derni\u00e8re version \u00e0 partir de cette adresse\u00a0: https:\/\/get.adobe.com\/flashplayer\/","mejs.fullscreen":"Plein \u00e9cran","mejs.play":"Lecture","mejs.pause":"Pause","mejs.time-slider":"Curseur de temps","mejs.time-help-text":"Utilisez les fl\u00e8ches droite\/gauche pour avancer d\u2019une seconde, haut\/bas pour avancer de dix secondes.","mejs.live-broadcast":"\u00c9mission en direct","mejs.volume-help-text":"Utilisez les fl\u00e8ches haut\/bas pour augmenter ou diminuer le volume.","mejs.unmute":"R\u00e9activer le son","mejs.mute":"Muet","mejs.volume-slider":"Curseur de volume","mejs.video-player":"Lecteur vid\u00e9o","mejs.audio-player":"Lecteur audio","mejs.captions-subtitles":"L\u00e9gendes\/Sous-titres","mejs.captions-chapters":"Chapitres","mejs.none":"Aucun","mejs.afrikaans":"Afrikaans","mejs.albanian":"Albanais","mejs.arabic":"Arabe","mejs.belarusian":"Bi\u00e9lorusse","mejs.bulgarian":"Bulgare","mejs.catalan":"Catalan","mejs.chinese":"Chinois","mejs.chinese-simplified":"Chinois (simplifi\u00e9)","mejs.chinese-traditional":"Chinois (traditionnel)","mejs.croatian":"Croate","mejs.czech":"Tch\u00e8que","mejs.danish":"Danois","mejs.dutch":"N\u00e9erlandais","mejs.english":"Anglais","mejs.estonian":"Estonien","mejs.filipino":"Filipino","mejs.finnish":"Finnois","mejs.french":"Fran\u00e7ais","mejs.galician":"Galicien","mejs.german":"Allemand","mejs.greek":"Grec","mejs.haitian-creole":"Cr\u00e9ole ha\u00eftien","mejs.hebrew":"H\u00e9breu","mejs.hindi":"Hindi","mejs.hungarian":"Hongrois","mejs.icelandic":"Islandais","mejs.indonesian":"Indon\u00e9sien","mejs.irish":"Irlandais","mejs.italian":"Italien","mejs.japanese":"Japonais","mejs.korean":"Cor\u00e9en","mejs.latvian":"Letton","mejs.lithuanian":"Lituanien","mejs.macedonian":"Mac\u00e9donien","mejs.malay":"Malais","mejs.maltese":"Maltais","mejs.norwegian":"Norv\u00e9gien","mejs.persian":"Perse","mejs.polish":"Polonais","mejs.portuguese":"Portugais","mejs.romanian":"Roumain","mejs.russian":"Russe","mejs.serbian":"Serbe","mejs.slovak":"Slovaque","mejs.slovenian":"Slov\u00e9nien","mejs.spanish":"Espagnol","mejs.swahili":"Swahili","mejs.swedish":"Su\u00e9dois","mejs.tagalog":"Tagalog","mejs.thai":"Thai","mejs.turkish":"Turc","mejs.ukrainian":"Ukrainien","mejs.vietnamese":"Vietnamien","mejs.welsh":"Ga\u00e9lique","mejs.yiddish":"Yiddish"}};
</script><script id="mediaelement-js-extra" type="nitropack/inlinescript" class="nitropack-inline-script">
/* <![CDATA[ */
var _wpmejsSettings = {"pluginPath":"\/wp-includes\/js\/mediaelement\/","classPrefix":"mejs-","stretching":"responsive"};
/* ]]> */
</script><script id="sp-ea-accordion-config-js-extra" type="nitropack/inlinescript" class="nitropack-inline-script">
/* <![CDATA[ */
var sp_easy_accordion_free = {"url":"https:\/\/www.chirurgies-esthetique-entunisie.com\/wp-content\/plugins\/easy-accordion-free\/","loadScript":"https:\/\/www.chirurgies-esthetique-entunisie.com\/wp-content\/plugins\/easy-accordion-free\/public\/assets\/js\/script.js","link":"https:\/\/www.chirurgies-esthetique-entunisie.com\/wp-admin\/post-new.php?post_type=sp_easy_accordion","shortCodeList":[{"id":4002,"title":"FAQ Chirurgie esth\u00e9tique en Tunisie"}]};
/* ]]> */
</script><script>(function(n){"use strict";if(!n.loadCSS){n.loadCSS=function(){}}var o=loadCSS.relpreload={};o.support=function(){var t;try{t=n.document.createElement("link").relList.supports("preload")}catch(e){t=false}return function(){return t}}();o.bindMediaToggle=function(e){var t=e.media||"all";function a(){e.media=t}if(e.addEventListener){e.addEventListener("load",a)}else if(e.attachEvent){e.attachEvent("onload",a)}setTimeout(function(){e.rel="stylesheet";e.media="only x"});setTimeout(a,3e3)};o.poly=function(){if(o.support()){return}var e=n.document.getElementsByTagName("link");for(var t=0;t<e.length;t++){var a=e[t];if(a.rel==="preload"&&a.getAttribute("as")==="style"&&!a.getAttribute("data-loadcss")){a.setAttribute("data-loadcss",true);o.bindMediaToggle(a)}}};if(!o.support()){o.poly();var e=n.setInterval(o.poly,500);if(n.addEventListener){n.addEventListener("load",function(){o.poly();n.clearInterval(e)})}else if(n.attachEvent){n.attachEvent("onload",function(){o.poly();n.clearInterval(e)})}}if(typeof exports!=="undefined"){exports.loadCSS=loadCSS}else{n.loadCSS=loadCSS}})(typeof global!=="undefined"?global:this);</script><style id="nitro-fonts">@font-face{font-family:"FontAwesome";font-weight:normal;font-style:normal;src:url("data:font/woff2;fontawesome-webfont.woff2;base64,d09GMgABAAAAAAHoAAoAAAAAA8QAAAGfAAEAAAAAAAAAAAAAAAAAAAAAAAAAAAAABmAARAqBGIEYCwoAATYCJAMQBCAFgiIHIBsHAyAuh3cESYfNidQheEq5aWcySfsaI10hw3AE5FpucnlA9SWHEi2QkWVfB4jjUcn6KvJV8n/an+++51CvbUlMMG+QUnYDJIT/74WHGVCEi/suUIoh8RGugQGu6ve/QfNds53O5O821oEmdTMOLOg8wkACT4IKOAo1wN4JhoQoOc/WIcsvoWcs6T4VuNS6cQ0g3NL7lm+5AgfcXprICxAA0AkhIkMDLaCBMQQUFUV0+rcHOexT9AUCAAkUkaEPGAYggQhCSr2T7Um3T4qdE9xTlkYvxLc/ga4KdPJbkWVMcveNqo38z2A78ewzzgeO6e2kmuohkdcBICCFr0/s1RVjFyiAv65Hz2KFPD7cJpDXRAlpHhLYyI7N5xMUkDsGAlLsSAkUpjAFAAWzaCGVsAhSBK1qiOrWken2zNMYcnq9LN96221m7mBpoKdvDfNo2iIwv6apjgNMT0vHTA1zGhvDi7YqBBIScQd+2KHmMzO15rRDrMxMEClEz8ZY05JPXExGhJOLXVyGj1dBQlxKRg6xtDIwM4UZqVmoaR9WTjM=") format("woff2");}@font-face{font-family:"FontAwesome";font-weight:normal;font-style:normal;src:url("data:font/woff2;fontawesome-webfont.woff2;base64,d09GMgABAAAAAAHsAAoAAAAAA/QAAAGjAAEAAAAAAAAAAAAAAAAAAAAAAAAAAAAABmAATAqBGIEaCwwAATYCJAMUBCAFgkgHIBs7AwCeA+7OIgwaAjGUg//5UqEslrHMI4j2+82ePFSySoZGiXjIqklLotKalaqh/aU1TYl1HTJegcbggIQBUuL1/PSMWv9rgT7sf4Bwg2Y7ncnfbQAcdUMrLIojjHAyCSwILMOdpxsyD8FvWLRBblLxrCrlvhgBPGBtOgLxAsb9i8MjPrz/yaCFRgBhAGNwSMgYRhAYRrQKdGqXJGPevf1PSHylG2gvAgBQQScyloA1AApIgChEUbXnpPvwqu/oyuU7vRvviM7bT1xmirj6YvQQWNfdB6Qez98Gpo5hlPqs8aphI/Mw2cHc36kT+wACJW6+5de/XY7rn8qgAHzVXGEn6ggyoF0CQaOFDhWk8XGRL+0Hhj3YhnqPQE1ckAIkhMA6ALTZQhCFBuyBGGFUB0mvY2QTrlHM+EY15Ueb/thBGzYd2TYzMbWLJ6RvH8IT1bc2coTHQEfPQoPHb2mJ16k7mYx8QmnCPxnRiNiwtsvvALJjwwpSgEzsWerbFpGVUZLiF+CQVRIRVpOTVVCaNOJJXYFs2zHb+8pjomGhYbx/nkAB") format("woff2");}@font-face{font-family:"trx_addons_icons";font-weight:normal;font-style:normal;src:url("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/source/rev-7c1dd13/wp-content/plugins/trx_addons/css/font-icons/font/d08089ceccf50cf1332056e8dcee65d7.trx_addons_icons.svg#trx_addons_icons") format("svg");}@font-face{font-family:"trx_addons_icons";src:url("data:application/octet-stream;base64,AAEAAAAPAIAAAwBwR1NVQiCMJXkAAAD8AAAAVE9TLzI+aUpjAAABUAAAAFZjbWFw27r/1wAAAagAAAvqY3Z0IAdn/nIAAPI4AAAAIGZwZ22KkZBZAADyWAAAC3BnYXNwAAAAEAAA8jAAAAAIZ2x5Zvy5eJ0AAA2UAADUhmhlYWQLYtB7AADiHAAAADZoaGVhCAwFIwAA4lQAAAAkaG10eJ4Q/xAAAOJ4AAADBGxvY2EsuGTHAADlfAAAAYRtYXhwBA8OGQAA5wAAAAAgbmFtZbCvFeIAAOcgAAADLXBvc3QLKkBEAADqUAAAB99wcmVw5UErvAAA/cgAAACGAAEAAAAKADAAPgACbGF0bgAOREZMVAAaAAQAAAAAAAAAAQAAAAQAAAAAAAAAAQAAAAFsaWdhAAgAAAABAAAAAQAEAAQAAAABAAgAAQAGAAAAAQAAAAEDeQGQAAUAAAJ6ArwAAACMAnoCvAAAAeAAMQECAAACAAUDAAAAAAAAAAAAAAAAAAAAAAAAAAAAAFBmRWQAQOgA6RIDUv9qAFoDmwDfAAAAAQAAAAAAAAAAAAUAAAADAAAALAAAAAQAAALaAAEAAAAAAdQAAwABAAAALAADAAoAAALaAAQBqAAAAAYABAABAALou+kS//8AAOgA6Q///wAAAAAAAQAGAXwAAAABAAIAAwAEAAUABgAHAAgACQAKAAsADAANAA4ADwAQABEAEgATABQAFQAWABcAGAAZABoAGwAcAB0AHgAfACAAIQAiACMAJAAlACYAJwAoACkAKgArACwALQAuAC8AMAAxADIAMwA0ADUANgA3ADgAOQA6ADsAPAA9AD4APwBAAEEAQgBDAEQARQBGAEcASABJAEoASwBMAE0ATgBPAFAAUQBSAFMAVABVAFYAVwBYAFkAWgBbAFwAXQBeAF8AYABhAGIAYwBkAGUAZgBnAGgAaQBqAGsAbABtAG4AbwBwAHEAcgBzAHQAdQB2AHcAeAB5AHoAewB8AH0AfgB/AIAAgQCCAIMAhACFAIYAhwCIAIkAigCLAIwAjQCOAI8AkACRAJIAkwCUAJUAlgCXAJgAmQCaAJsAnACdAJ4AnwCgAKEAogCjAKQApQCmAKcAqACpAKoAqwCsAK0ArgCvALAAsQCyALMAtAC1ALYAtwC4ALkAugC7ALwAvQC+AL8AwAAAAQYAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAADAAAAAAJEAAAAAAAAADAAADoAAAA6AAAAAABAADoAQAA6AEAAAACAADoAgAA6AIAAAADAADoAwAA6AMAAAAEAADoBAAA6AQAAAAFAADoBQAA6AUAAAAGAADoBgAA6AYAAAAHAADoBwAA6AcAAAAIAADoCAAA6AgAAAAJAADoCQAA6AkAAAAKAADoCgAA6AoAAAALAADoCwAA6AsAAAAMAADoDAAA6AwAAAANAADoDQAA6A0AAAAOAADoDgAA6A4AAAAPAADoDwAA6A8AAAAQAADoEAAA6BAAAAARAADoEQAA6BEAAAASAADoEgAA6BIAAAATAADoEwAA6BMAAAAUAADoFAAA6BQAAAAVAADoFQAA6BUAAAAWAADoFgAA6BYAAAAXAADoFwAA6BcAAAAYAADoGAAA6BgAAAAZAADoGQAA6BkAAAAaAADoGgAA6BoAAAAbAADoGwAA6BsAAAAcAADoHAAA6BwAAAAdAADoHQAA6B0AAAAeAADoHgAA6B4AAAAfAADoHwAA6B8AAAAgAADoIAAA6CAAAAAhAADoIQAA6CEAAAAiAADoIgAA6CIAAAAjAADoIwAA6CMAAAAkAADoJAAA6CQAAAAlAADoJQAA6CUAAAAmAADoJgAA6CYAAAAnAADoJwAA6CcAAAAoAADoKAAA6CgAAAApAADoKQAA6CkAAAAqAADoKgAA6CoAAAArAADoKwAA6CsAAAAsAADoLAAA6CwAAAAtAADoLQAA6C0AAAAuAADoLgAA6C4AAAAvAADoLwAA6C8AAAAwAADoMAAA6DAAAAAxAADoMQAA6DEAAAAyAADoMgAA6DIAAAAzAADoMwAA6DMAAAA0AADoNAAA6DQAAAA1AADoNQAA6DUAAAA2AADoNgAA6DYAAAA3AADoNwAA6DcAAAA4AADoOAAA6DgAAAA5AADoOQAA6DkAAAA6AADoOgAA6DoAAAA7AADoOwAA6DsAAAA8AADoPAAA6DwAAAA9AADoPQAA6D0AAAA+AADoPgAA6D4AAAA/AADoPwAA6D8AAABAAADoQAAA6EAAAABBAADoQQAA6EEAAABCAADoQgAA6EIAAABDAADoQwAA6EMAAABEAADoRAAA6EQAAABFAADoRQAA6EUAAABGAADoRgAA6EYAAABHAADoRwAA6EcAAABIAADoSAAA6EgAAABJAADoSQAA6EkAAABKAADoSgAA6EoAAABLAADoSwAA6EsAAABMAADoTAAA6EwAAABNAADoTQAA6E0AAABOAADoTgAA6E4AAABPAADoTwAA6E8AAABQAADoUAAA6FAAAABRAADoUQAA6FEAAABSAADoUgAA6FIAAABTAADoUwAA6FMAAABUAADoVAAA6FQAAABVAADoVQAA6FUAAABWAADoVgAA6FYAAABXAADoVwAA6FcAAABYAADoWAAA6FgAAABZAADoWQAA6FkAAABaAADoWgAA6FoAAABbAADoWwAA6FsAAABcAADoXAAA6FwAAABdAADoXQAA6F0AAABeAADoXgAA6F4AAABfAADoXwAA6F8AAABgAADoYAAA6GAAAABhAADoYQAA6GEAAABiAADoYgAA6GIAAABjAADoYwAA6GMAAABkAADoZAAA6GQAAABlAADoZQAA6GUAAABmAADoZgAA6GYAAABnAADoZwAA6GcAAABoAADoaAAA6GgAAABpAADoaQAA6GkAAABqAADoagAA6GoAAABrAADoawAA6GsAAABsAADobAAA6GwAAABtAADobQAA6G0AAABuAADobgAA6G4AAABvAADobwAA6G8AAABwAADocAAA6HAAAABxAADocQAA6HEAAAByAADocgAA6HIAAABzAADocwAA6HMAAAB0AADodAAA6HQAAAB1AADodQAA6HUAAAB2AADodgAA6HYAAAB3AADodwAA6HcAAAB4AADoeAAA6HgAAAB5AADoeQAA6HkAAAB6AADoegAA6HoAAAB7AADoewAA6HsAAAB8AADofAAA6HwAAAB9AADofQAA6H0AAAB+AADofgAA6H4AAAB/AADofwAA6H8AAACAAADogAAA6IAAAACBAADogQAA6IEAAACCAADoggAA6IIAAACDAADogwAA6IMAAACEAADohAAA6IQAAACFAADohQAA6IUAAACGAADohgAA6IYAAACHAADohwAA6IcAAACIAADoiAAA6IgAAACJAADoiQAA6IkAAACKAADoigAA6IoAAACLAADoiwAA6IsAAACMAADojAAA6IwAAACNAADojQAA6I0AAACOAADojgAA6I4AAACPAADojwAA6I8AAACQAADokAAA6JAAAACRAADokQAA6JEAAACSAADokgAA6JIAAACTAADokwAA6JMAAACUAADolAAA6JQAAACVAADolQAA6JUAAACWAADolgAA6JYAAACXAADolwAA6JcAAACYAADomAAA6JgAAACZAADomQAA6JkAAACaAADomgAA6JoAAACbAADomwAA6JsAAACcAADonAAA6JwAAACdAADonQAA6J0AAACeAADongAA6J4AAACfAADonwAA6J8AAACgAADooAAA6KAAAAChAADooQAA6KEAAACiAADoogAA6KIAAACjAADoowAA6KMAAACkAADopAAA6KQAAAClAADopQAA6KUAAACmAADopgAA6KYAAACnAADopwAA6KcAAACoAADoqAAA6KgAAACpAADoqQAA6KkAAACqAADoqgAA6KoAAACrAADoqwAA6KsAAACsAADorAAA6KwAAACtAADorQAA6K0AAACuAADorgAA6K4AAACvAADorwAA6K8AAACwAADosAAA6LAAAACxAADosQAA6LEAAACyAADosgAA6LIAAACzAADoswAA6LMAAAC0AADotAAA6LQAAAC1AADotQAA6LUAAAC2AADotgAA6LYAAAC3AADotwAA6LcAAAC4AADouAAA6LgAAAC5AADouQAA6LkAAAC6AADougAA6LoAAAC7AADouwAA6LsAAAC8AADpDwAA6Q8AAAC9AADpEAAA6RAAAAC+AADpEQAA6REAAAC/AADpEgAA6RIAAADAAAAAAv/9/2oD6wNSACcAUABRQE4kFgYDAQJMQjQDBAMCRwABAgMCAQNtBwEDBAIDBGsGAQAAAgEAAmAABAUFBFQABAQFWAAFBAVMKSgBAEdFMS8oUClQFBIMCgAnAScIBRQrASIHBgcGBxQWHwEzMjU2NzY3NjMyFhcHBhYfARY+AS8BLgEPASYnJgEiFQYHBgcGIyInJic3NiYvASYOAR8BHgE/ARYXFjMyNzY3Njc0Ji8BAe6DcW1DRQUFBARUEwU1M1NXY0+ONDoJAgz3CxQKBDoCEglBRFpcATMTBTUzU1ZjUEhFNTsIAgv4CxQKBDoCEgpARFpdZoJxbkJFBQUEBANSQD5rboEICQIBEmJTUS8xPjg5CRMDMgMJFhDjCAsGPEYmKP4EEmJTUS8xIB44OQkTAzIDCRYQ4wgLBjxGJihAPmtugggIAgEAAAAMAAD/agPoA1IADwAhADUASQBcAG0AfgCQAKQAuADKANoAq0CoDAECARwEAgACVU0CBAB7c2piBAMGiwEIBcQBCwfXvAIJC88BCgkIRw0BAgEAAQIAbRABCAUHBQgHbQAHCwUHC2sACQsKCwkKbQwBAQAABAEAYA4BBAADBQQDYA8BBgAFCAYFYBEBCwkKC1QRAQsLClgACgsKTMvLpqVubl1dIyIAAMvay9nT0cLApbimuImHbn5ufXd1XW1dbGZkIjUjNQAPAA4mEgUVKwEiBh0BFBY7ATI2PQE0JiMXJg8BBhYfARUWNj8BNiYvASYFIg8BDgEfATAxHgE/AT4BLwE1JgUiDwEwMQ4BHwEeAT8BMz4BLwEmBSIPAQYWHwEWNj8BMDE2Ji8BJgUxIgYdARQWOwEyNj0BNCYjBTEiBh0BFBY7ATI2PQE0JiMFIg8BIwYWHwEWNj8BNiYvASYFIg8BIw4BHwEeAT8BMDE+AS8BJgUiDwEOAR8BFR4BPwE+AS8BMDEmBSIPAQYWHwEWNj8BNiYvATAxFyIGHQEUFjsBMjY9ATQmIwHOBAcHBEYFBwcFtAYEWwMCBTwECgJbAgIEPQH+UAIEPQQCAlsCCQU9BAICWwMCZQQCnQQDAiMDCQSdAQQCAiMD/M8IAyMCAgSeBAoCIwICBJ4EAscEBwYFtwUGBgX8LwUHBwW2BQYGBQJOBwMiAQICBJ4ECgIjAgIEngL9xgMCnQEEAgIjAgoEnQQDAiMGAc8EAj0EAgJbAgoEPQQCAlsD/ooHA1sCAgQ9BAkCXAIDBDyPBQcHBUYFBgYFA1IGBbcEBwYFtwUGLwEGngQKAiIBAgIEngUJAiMBAgIjAgoEnQQDAiMDCQSdAQajAVsCCQU9BAICWwIKBD0HBgY9BAkCWwMCBTwECgJbAusGBUYFBwcFRgUGBQcFRgUGBwRGBQeZBjwECgJbAgIEPQQJAlwBBQFbAgoEPQQCAlsCCQU9BnoBIwMJBJ0BBAICIwIKBJ0GAgaeBAoCIwICBJ4FCQIjOAYFtwUGBwS3BQYAAAABAAD/nAMgAyAAJwBEQEEhAQUEFAsCAgMmBwIBAANHAAQFBG8ABQMFbwADAgNvAAIAAm8GAQABAG8AAQFmAQAgHhsaExEODAUEACcBJwcFFCslMhYUBiImNTQ2NSUGIyImNDYzMhclNCY1NDYyFhQGIyInBRYUBwU2Aoo+WFh8WAL+/CoyPlhYPjYmAQQCWHxYWD40Jv76AgIBBiTIVn5YWD4GEAScIFh8WB6cBBAEPlhWflggnAgiCJweAAP//f+xA18DCwACAAkAFgArQCgFAQAFAUcABQAFbwAAAwBvAAMBA28CAQEEAW8ABARmFRQREhERBgUaKwEXIwUzCQEzNyElFA4BIi4CPgEyHgEBrXDhATw1/wD+/zU6ASMBG3LG6MhuBnq89Lp+AferfQGC/n5ZNnXEdHTE6sR0dMQAAAYAAP9pAxIDDQAIABEAHgA4AE0AWQC7t0lGQAMACwFHS7AJUFhAQAALAAALYw0OAgIKCQoCCW0PAQkDCgkDawwBAwQKAwRrCAYCBAUKBAVrBwEFBW4BAQAKCgBUAQEAAApXAAoACksbQD8ACwALbw0OAgIKCQoCCW0PAQkDCgkDawwBAwQKAwRrCAYCBAUKBAVrBwEFBW4BAQAKCgBUAQEAAApXAAoACktZQCUfHxMSWFdSUUhHPTwfOB84NTMwLywrKCckIhkYEh4THhgQEAUWKwEyPgEmDgEeARcyNjQmDgEeAQUyFgcVFAYiJj0BNDYFERQGKwEVFA4BJic1IxUUDgEmLwEjIiYnESUeARUhNDY3JyY3Nh8BNjIXNzYWBxMVFAYiJj0BND4BFgETCQwCEA4QBAj3CQwMEg4CCv5GFyIBIDAiIgJnJBkqIDIgAU0gMSABASkaIgEBfztI/fxGPScEBggEKDV2NSgEDgTjIi8iIi8iAkQOEBAECBgGBA4QEAQIGAZqIhfwGCIiGPAXIgv+jRokfxggAiQWf38YIAEiF38kGgFz4h9sQ0JuHkkIAwQHShgYSgcHCP6n8BgiIhjwGCABIgAAAAAGAAD/agLEA1IABwANABkAKgBuAJoApkCjgQ4CAQAUAgEDDgGMeQIGDnJICwMNB2MJAgMNWwEMClIBCQsHRwABAA4AAQ5tAAYOBA4GBG0IAQcEDQQHDW0ADQMEDQNrAAkLBQsJBW0ADwACAA8CYAAQAAABEABgAA4ABAcOBGAAAwAKDAMKXgAMAAsJDAtgAAUREQVUAAUFEVgAEQURTJeViIZ/fXh2bWtmZV9dWVdWVCIWKCYaFSQaJRIFHSsBBxc2NTQjIgMXNjcnJgMUFzYzMhcnJiMiBgMUHgE3MjY3NCcuAwciBgcUFx4BNzI2PQE0JicuASMiBwYUHgIyFjczMhYXBgcGBw4BFxQWFQcGFSYnBiMWFRQGByImNTQ3FxYzMjY1NCYjIgYHNDY3JjU0NjMyFwI1NDYzMhMXNz4DMzIWFRQHHgMXFA4CByInLgECFEBBXRYf0BIVEygWn1kKEQgiRCkbCwotOkgUCAwBEgcWICQQDBxYDiGKWH+rDgofrkAUBwcYJjAyLhANDRECDyYiEiQyARQBA0wFBRIBLB8uXhIiKx8HEGIQGB5AMDQQRCMQF1suK0lsBSgLJiIuEyguWSIsFgYBNGCKVz4+U3oCf7cM/CUg/gMxFw4HBAH1N+wGA8R6Ev5MFFxQARAHDSwRLjQoAx7GFyNRXAG9kCUNLAkbHgYDJBwQDAQCFRQQDwwNGkwmEkARBgcBBXMBBAceKAFYLRMSKjoICBN8Mh85RA8qECNECAEBOy04/rwNbh9SNio4KDz3CCI2MiVTkmo8ARcglgACAAD/sQMJA1IAIAAwAHNACigBBAMaAQEEAkdLsApQWEAZAAUDBW8AAwQDbwAEAQRvAAEAAW8CAQAAZhtLsAtQWEAVBQEDBANvAAQBBG8AAQABbwIBAABmG0AZAAUDBW8AAwQDbwAEAQRvAAEAAW8CAQAAZllZQAkhISQhEiMGBRorJQYHBiMiJyYiBiMiAjU0NjMyFjMyNjMyFxYXBgcGFRQWAxQGBwYHBgc+ATceAR0BFAMJFS9ISBszMEZbHFWlfmAodBMZcChCNR0dLRMkTJ8hJB4eFCYCU2IBAqxGRW4SEiYBI4d/oiImJBQkJR00P0VwAoEiVCMeCwYDU3gXAggCBgMAAAAGAAD/+AR4AsQAAwAJAB8AJgAuAEEBOLU3AQoCAUdLsBNQWEBQAAANAQ0AAW0AAQwHAWMABQgJBAVlAA0ADAcNDGAABw8BAgoHAmEACwAKAwsKYAADAAgFAwheEAEEDgYEVAAJAA4GCQ5gEAEEBAZZAAYEBk0bS7AUUFhAUQAADQENAAFtAAEMBwFjAAUICQgFCW0ADQAMBw0MYAAHDwECCgcCYQALAAoDCwpgAAMACAUDCF4QAQQOBgRUAAkADgYJDmAQAQQEBlkABgQGTRtAUgAADQENAAFtAAEMDQEMawAFCAkIBQltAA0ADAcNDGAABw8BAgoHAmEACwAKAwsKYAADAAgFAwheEAEEDgYEVAAJAA4GCQ5gEAEEBAZZAAYEBk1ZWUAnCwoFBEE/MS8uLCknJiQiIB0cFxURDw4NCh8LHwgHBAkFCREQEQUWKwEhFSEHIgYHMyYDMjY3MwYjIiY1NDYzMh4BBxQHIRQWJTMyNTQrATUzMjY3NCsBJyEyHgIVFAceARcUDgMnIQQH/uMBHYwzPgPjClwjQgl7N7d3jpJzTXI6AQH+kUD9VKVyb6icLDIBapGbAUwwTEIiYEBAARwuQEYo/qsClUWpOjNt/rokHquSeXSaTHxNCRE+RB1dZGoqKlB4ECRIMmUuEV5DKUYuIBABAAAABQAA/5YDEgMzAAoAFQApAEIAZgAhQB5YPzwgBAFFAAEAAAFUAAEBAFgAAAEATD49MjECBRQrARYGJy4BNjc2HgEXLgEHDgEXHgE+ARMuAS8BJgcOAgceAR8BFj8BPgETDgMHDgEmJy4DJyYnPwEWIDceAQYTBgMOAgcGJyYnLgIvASYvAS4BJz4DPwE2NzYXFhcWFAHHBEAfFRAOFhQqHEAIbjcjKgEDUmZEfwsoDCiimhgaIgsQNA8xf3syDzIxBQgIFhYwdGw7GSguJAsOEQMKfAE+fAwCCGUPLwMYGBOMyItRCAwIAQMCAR8GDgUCEBIiCBtGadOmViIJAXMjLBMJLi4JCgYiCTxAGQ9EJjNICVYBYQ8UAgcaGwQGEg8QFAIGEA8HAhT9zg44JigMGxoCCQUKFB4TNm0JBVNTAxQeAhNe/vARHBIIRhUPPwYQGAcWDwSuImInDhoQEgMKGgoVMRkrCyIAA////7EDWgMLAAIACQAZADhANQIBAAIJAQEAAkcAAAIBAgABbQAFAAIABQJeAwEBBAQBUgMBAQEEWAAEAQRMNTURERIQBgUaKyUjGwEzAyMDMzcBERQGByEiJjcRNDY3ITIWAf+kUoKttfW1rtUBWV5D/elCYAFeQwIXQmD0ATP+GQI8/cSwAXr96EJeAWBBAhhCXgFgAAAEAAD/sQR3AwsAGQA1AFcAWwDsS7AQUFhAPAkBAwQABANlBgEABQUAYxABDwAMAg8MYAgBAgoBBAMCBGALAQUHAQENBQFhAA0ODg1UAA0NDlYADg0OShtLsBFQWEA9CQEDBAAEA2UGAQAFBAAFaxABDwAMAg8MYAgBAgoBBAMCBGALAQUHAQENBQFhAA0ODg1UAA0NDlYADg0OShtAPgkBAwQABAMAbQYBAAUEAAVrEAEPAAwCDwxgCAECCgEEAwIEYAsBBQcBAQ0FAWEADQ4ODVQADQ0OVgAODQ5KWVlAHlhYWFtYW1pZUU8/PTQyLCooJyQiESYiEiMiEBEFHSsBMw4BByImNDY3MhYXIy4BByIGBxQeAjMyJTMOAQciJjc0NjcyFhcjLgEHIgYXFB4CMzI2NzQmJyYvASYhIA8BDgEHDgIWFx4CFx4BFyA/ATY3PgETESERAbZ0CF5JWmhoTlNeB3EDIh0gIgEGDh4WNQGVcwdeSVpoAWZQUl4HcgIiHCAkAQQQHBcbIMsSGQMEFTD+q/6jLwoHCgMZEAESGAQKDAQY2poBVDEVBgEaEGz7iQEgWWQBgtyCAWJZJCgBREEaKCYUTllkAYJvbYIBYlkkKAFEQRooJhQqZnNwIgUDDiQkBgQIBCFw6HAhBQgGBBMQASQOBAUhcAId/KYDWgAAAAAIAAD/agPoA1IAAwAGAAoADgASABUAGQAtAC1AKhkYFxUUEhEQDg0MCgkIBwYFBAMCARUAAQFHAAEAAW8AAABmKikgHwIFFCs3BTUnBzcnASUnByc3JwcnNzUNARc1BzclFQURFAcBBiInASY1ETQ3ATYyFwEWeQFQurlsbAHJAVCWuiuYmJhNuv6wAq1suZb+sAHJE/43DBgM/jcTEwHJDBgMAckTxuHJfBRISP4/4WR8SmZmZjR8yeGYSJAUZOHJGP7QFw3+zwcHATENFwEwFw0BMQcH/s8NAAAAFwAA/2oEdwNSAEYATgBcAGMAaABtAHIAeQB+AIMAiwCQAJUAmQCdAKAAowCoALAAswC2ALkAwgDbQNg7LgIPBq4BEQ+ysZiUk5KQjItfCgoRwL++s7Cvq6aloJ+dnJuZj46NioSBfn18bGtqZ1pZWFdPQSgjEgofBgIMEri2dwMODAwBAQsHRwAKERIRChJtCAEGEAEPEQYPXgkHAgUAEQoFEWAYFxYcExsGEh0aGRUUBQwOEgxeAA4LAA5UDQELAwEBAAsBXgAODgBYBAICAA4ATLe3aWlkZLe5t7m1tKOigH97enZ1cXBpbWltZGhkaGNiYWBeXU5NTEtKSUhHPz45ODc2NTQzMjEwERERER4eBRkrARQGDwEWFRQGDwEWFRQOAScjBiInIwYiJjc0NycuATU0NycuATQ2PwE1ND8BJjU0NjIXMzYyFzM2MhYXFAcXMhYVFAcXHgEBMycjBzM2MgEcAQcXMzIfATc1JwYHJSMXJSMGIgE0NycHIzcnBx8BPwEjFwUzNyMVFxYnMzcnDwEzNQcWETAdARQHFzU3FRc3LwEHFTcnJSMFFxUHFzclJxUFBzM3FxMnIycmPQEvAQMXATUHEyMXJQc/AiY1NycDFzYEdw4McgEOC2sBEhsJ4AkeCd4KGxQBAmsMDgJzCw4QCm8TdAIUGgrdCR4J3wobEgECcw0SBGgLDv3a2b9Pv8kKFv35AXQDAgECaWgHCQF72GoBNZwJGgGBAiMKEQ2NpSPRCSTuuv4IAr/QAggK4CSsWGxbXQIEXxFVpnx9AnJqAesI/qV3pq6l/phMAQ8XL6SFSQEBDAV4CPOt/i9bW1tbAl4bSRZzAQJgSCsDAV8MEgLGBQUMEAO8BQQNEgEKCwsLEg4EB7sCEgsFBcYDEhYSAsADFAnKBgQOEgwMDAwSDgMHyBINBwi1AhL+OMXFCQG8AgsDyQIBb8JsBQH6b28J/WUDAyYsO5SrJM0Prb8GxbsDA9Ils117aWIFAcoBAQkHY5YGrVivhHwElCpwBX19GLCyqwlOnnsZ24wBXAMMBwkB0gP+/bYBGH2e/hGenn9/J8oFAwml/qouAgAAAAEAAP+OA+EDCwAPAC9ALAgHBAMEAUQAAQIBcAAAAAQDAAReAAMCAgNSAAMDAlYAAgMCShERFBQQBQUZKxMhAwUlNzMHFyU3ITchNyGZA0iU/j/+eyemEOsBECb9XSECohb9XgML/RiVlcZSWVm+pWsAAAAAAgAA/2oDEgNSAA0AGwAzQDAPAQMCAUcFAQBFAAAAAgMAAmAEAQMBAQNUBAEDAwFYAAEDAUwODg4bDho3NCIFBRcrETQ2MyE3ERQGIyEiJjUlJzU0JichIgYVERQWF2ZJAZ7FZkn+TElmArBjJBn+8hokJhgB10lqyPzMSmpqShRk7RokASYZ/u4aJAEAAAAAAgAA/7EDWQMLAA0AHQAzQDAAAAECAQACbQACAwECA2sABQABAAUBYAADBAQDVAADAwRYAAQDBEw1NSETIREGBRorJREhESEiBhcRIREhMjYTERQGByEiJjURNDY3ITIWAzX+eP70NEoBAYkBCzRKI15D/elDXl5DAhdDXlIBDAGJSjP+9P53SgJL/ehCXgFgQQIYQl4BYAABAAD/sQI7A1IAEwA4QDUAAQQFCgECAQJHAAUEBW8AAgECcAAEAAMABANeAAABAQBSAAAAAVYAAQABShMRExMREgYFGisBAxczFSEPAiM1EycjNSE/AjMCO6kOm/7mGU8RqKkNnAEbGU8QqAKp/rsR6BCZEaoBRRHnEZgRAAAAAAgAAAAABHcCtQAFAAkADQARABkAHQAlACkAikCHFwEIAAhvAAAHAG8ABQELAQULbQAHFgEGAgcGXg8JAgITDQIDBAIDXhkUGA4VBQQSDAIBBQQBXhEBCwoKC1IRAQsLClYQAQoLCkomJhoaDg4KCgYGJikmKSgnJSQjIiEgHx4aHRodHBsZGBcWFRQTEg4RDhEQDwoNCg0MCwYJBgkSEREQGgUYKxMzESERMxE1IxUTETMRJxUzNRchESE1MzUjNzUjFRMhESE1MzUjNzUjFbdy/te3ReVycnIuASn+17e3t0XlASn+17a2tkQCtf3bAYX+187OASn+ewGFoHJyoP3yWy5czs4BKf3yWy5czs4ACP/9/7EDXwMLAA4AHwAmAC0AMAA8AFMAYABoQGVGPzc1IgUCAxEBBAJKAQUEPSspFwsCBgAGBEcABAIFAgQFbQAFAQIFAWsABgEAAQYAbQAIAAMCCANgAAIAAQYCAWAAAAcHAFQAAAAHWAAHAAdMXl1YV1JRUE9OTDQyJiUULAkFFislJicjBw4EBycWMzIDJicGIxUUFhc+Az8BPgEnJicOAQcyBSYHFhc+AQEiMQUmIyIHFhc+AzcTJicHDgQHHwEWFzc2FjIeAjIfARQOASIuAj4BMh4BAjsXNwEBCR5SSEoUCWeDSSIMEa7KMC0cUk5EFRUCCjlDRk1qE6kCJ3VvMRY+VP5KAQFKZ4orLElAJ0QoIAWEAlEBBQwkLEIpGQMCAykVKCYgIBYSBURyxujIbgZ6vPS6fg2GkAEDDCoyTisGVAFwGyM0DEV+MTFYMigHBwECeHdcJIhUhSERhYEqgAHpUFsLXncPJh4iBv77gWQBBw4iIiYRNQoGAwQCAgQCBgMFdcR0dMTqxHR0xAAAAAAFAAD/sQPEAxAAAwATABcAGwAfAA9ADB4cGhgWFA8HAgAFLSsTBQclBRUFFTUHNSU1Fzc1FzUVFwEXBScFFwUnEwUHJeABFL/+7wLj/u4B/u9SvwHA/oC//uy8AuS8/u+/vwERvP7sAceqn7KePKQBAQEBpDw2nwEBAQGfArSfqpeXl7KfAfOyl6oAAAQAAP9yA1kDSAAWADUAWwCCAT1ACjQBAAcBR3YBBkVLsAlQWEA9AAYEBm8ABAUEbwAFCAVvAAMCBwIDB20JAQcAAQdjAAABAgABawAIAAIDCAJgAAEKCgFUAAEBClkACgEKTRtLsApQWEBDAAYEBm8ABAUEbwAFCAVvAAMCCQIDCW0ACQcCCQdrAAcAAQdjAAABAgABawAIAAIDCAJgAAEKCgFUAAEBClkACgEKTRtLsAtQWEA9AAYEBm8ABAUEbwAFCAVvAAMCBwIDB20JAQcAAQdjAAABAgABawAIAAIDCAJgAAEKCgFUAAEBClkACgEKTRtAPgAGBAZvAAQFBG8ABQgFbwADAgcCAwdtCQEHAAIHAGsAAAECAAFrAAgAAgMIAmAAAQoKAVQAAQEKWQAKAQpNWVlZQBZhYFdVUlFNS0VDPz07Oi4tKhkkCwUXKwUmBw4BByInJiIHBhQXHgEyNz4CNzYnJicmIyIHBgcGFxY2PwE2MjYyNhY2FzIeARceATc2NzQuAiIOAScGLgMHIgYHBhceATcyPgIXHgMzFjY3PgE3FA4CLgMnND4FNzY/AT4BNz4BNxYXHgEXHgYCiwMKEUApSCMDCwgEBBM8NhwXMBgEBxkKCw0eGg0QHA4HBQoNBgUCCAYGDAYJDxIIBAUEBQzCBgwaI0hIFA8qKjQ6IUFaAgEqECYnIFJEQhMPKiYmDBQaEg8QHkR2mK6YfEIDFiAwJjIWDQgUHwsgERQaA0ggGWAYCxYsKioiEiMKBw0SARwCBwMMBRIOAgIUDAYGShoICQYHGA4LBAQLBQQIBgIGAwgICAoCAQepDBoYEC4wAQEYHiIWAVg3Px0LCgEkKiYCASIoJAESGhdEclueaEAEPHSaWzJcSDwsIhIEBQoQBhYNEDItVxUQLA8HDCgoQkZgAAEAAP+xAhcDUgAUADNAMAABAAYBRwADAgNwAAYAAAEGAGAFAQECAgFSBQEBAQJWBAECAQJKIxERERETIQcFGysBFSMiBh0BMwcjESMRIzUzNTQ2MzICF1cwIqQWjquOjnRhUgNLkygoaqX+WAGopXpocgAAAwAA/7EDWQMLAA8AGAAhACxAKQYBAAIAbwQBAgMCbwUBAwEDbwABAWYBACAfHBsXFhMSCQYADwEOBwUUKwEyFhURFAYHISImNRE0NjcTNCYOAh4BNiU0Jg4BFB4BNgK4Q15eQ/3pQ15eQ+VGYkQCSF5KAThEZEREZEQDC2BB/ehCXgFgQQIYQl4B/lMxRgJCZkICRjExRgJCZkICRgAAAAQAAP+zA1kDCgAKABQAHgApABdAFCgmIyEYEhANAwkARAAAAGYoAQUVKwEGAAcmNTQ+ARcyFxYXBgAHJic2AAM2ADcWFw4BByYFJicGBz4BNwYHFgIJsf72QwtyxnMuxjQo2f7APTQiPgE8w0ABKMYWCKP6QjoCIGxhS1Y8uHILLSQC/kP+8rIyMHXEdAFNJDM//sDaKTLXAT79V8cBKkEzOkP6pQgLHCQvDHK4PlVJYgAAAAMAAP+wArkDUgAiAD0AQgA6QDcIAQMAPwEEAQJHCQEERAAFAAADBQBgAAMAAgEDAmAAAQQEAVQAAQEEWAAEAQRMOys1JjgkBgUaKwE3NiYnISIGFxEUPwE+ATsBMjY/ATYmByMiJic1NDY3MzI2Nw4CBw4EKwEiBgMOAScmNRE0NjchMhYHAzc+AQIuFQIODf5zDRIBA6INEhGGDBACFQIQDaQQFAEWD8EKFIAJKiQBBAIODhwTlwcK6QwqBh4qLgHvNSQMWBMRLAJgbA0SARQK/ZkEBMQPCBAJagwWARYQFxAUAQ6GKdiuCgwMGA4KC/7yDgQFDCoDEx80ATw6/kdhWNYABgAA/2oDwgNSAAYADwA7AEcAawB0AQBAGFlSExEEAwpIMQIPA0ksAgcPA0cQAQUBRkuwDlBYQFoADBEQCAxlAAYIAggGAm0AAwoPCgMPbQAHDwkPBwltAAAJAQkAAW0AEQAQBREQYAAFAAIKBQJgDQsCCA4BCgMICmEADwAJAA8JYAABBAQBVAABAQRYAAQBBEwbQFsADBEQEQwQbQAGCAIIBgJtAAMKDwoDD20ABw8JDwcJbQAACQEJAAFtABEAEAUREGAABQACCgUCYA0LAggOAQoDCAphAA8ACQAPCWAAAQQEAVQAAQEEWAAEAQRMWUAjc3JvbmtpZ2NiYV9eW1pYV0xKQ0I9PDs6OTcmJCIjISESBRgrJTQjIhQzMgM0JiciFRQzMhMVBgcWFRQGBw4BFRQeBRcUIyIuAjU0NzUmNTQ3NS4BJzQ2FzIXMhMjNjURNCczBhURFCUVBiMiLgM9ATM1IyInIgc1MzU0JzMGFTMVIiYrARUUMzIBFAYuAj4BFgFMXFhgVCEiIEVFQpYUGAlSRRYWGiYyLioWAssmRD4kZiYjKDQBak42Ljb1fAICfAMBUig5IzIcEAQBCwcDDBU2BH8DXwggCC8wIv7aLEAsASxCKgU4cwHgIywBUUsBAXAHBhgXRmQNBRQXERYOChQWMB+qDiA8KVwhAxYwPQ8DDV4tTmgBGv4vGTEBVDUTEzP+qjFjbhYYHjosJMQCAQNqKh4UF0VqAsxJAiMgMgEwQjABMgAAAAAEAAD/sQOhAsMADAAZADMAWgBLQEhZUk5HBAIIDQACAAMCRwkBBwgHbwAIAghvBAECAwJvAAMAA28BAQAFAG8ABQYGBVQABQUGWAAGBQZMVVQjHUs3IhIrHBMKBR0rJRQOAS4DPgIeAQUUDgEuAz4CHgEXNCYjIgcGIicmIyIGBxQeAzczMj4DNxQHDgQHIi4EJyY1NDcmNTQ3MhYXNjMyFz4BNxYVFAcWAWUOIi4kDAIQIDIeEgFjDiIuJAwCECAyHhJYTkEXVihgJ1UYQkwBJDZSSi5eLkpSOCJ+IhZKVGpWMitIXE5MOhMjTA8cPVo9UlpTSTtcOx0PTKsWLigCJDIoNCIEKiwYFi4oAiQyKDQiBCosGENeDAYGDF5DMUgsFgwCCBooTJJ0RSs+IhQEAQQKGCA8IkV0hFktMUE5LC8UEi4qATlBMC1aAAMAAP+wAowDUgAaAC8AXgBPQExUAQgDAUcAAwIIAgMIbQAIBwIIB2sJAQQFAQIDBAJgAAcAAAEHAGEAAQYGAVQAAQEGWAAGAQZMMTBXVVBPR0UzMjBeMV4pKCkqCgUYKyU0LgYnJiMiDgMUHgMXMj4CAzQuAiciBgcGFRQeAxcyNjc2AzMHIx4BFxQOBB4DFxQHDgEnIiYnJjU0Njc2Ny4BNDcGIyImJzQ2Nz4BAiMGDBIOHgokAgkTHTo+Lh4aKjY6HCA8MiBCEiQ6JBgsDxoMFiQwHhQuDh0+6ExKKioBHCYoGgEkMjQiARwnnFhKgCAUMilJmBESDBoMU3ABKCMrdmcOGhYYDhoGGgIBCBQeNj80IBgIAQ4eNAICIUpGLAEWEiE4Gjo4MBoCFA4fAUYxI04zKEAoICQnKCIwRiwzLURCATA0ISguTBouChckLRoDbFMtVh4lJAAAAAQAAP+wA4UDUgAwAEUAYABsAG1AahoBAgUBRwAOBAUEDgVtAAIFCgUCCm0ACwEIAQsIbQADBgEEDgMEYA0JAgUMAQoBBQpeAAEACAcBCGEPAQcAAAdUDwEHBwBYAAAHAExHRmxramloZ2ZlZGNiYVdVRmBHYCgZEScmGCoQBRsrARQeAxcUBw4BJyImJyY1NDY3NjcuASc0NwYjIiYnNDY3PgE7AQcjHgEVFA4DJzI2NzY1NC4CJyIGBwYVFB4DEzI+Aic0LgYnJiMiDgMVFB4CATMVIxUjNSM1MzUzAZokMjQiARsonFhKgB8VMilJmBIQAQwaDFNwASgjK3Y/6U1JKSoaKCYcURUsDx4UIjwjGCwPGgoaIDQdIDwyIAEICBYKIgYoAQgSHjo+Lh4mQEYB6Hd3O3Z2OwGWFCgiMEYsMi5EQgEwNCInLkwaLgoYIhgUHANsUy1WHiUkMSNOMyhAKCAkIhQOIDkgSkgqAhYSITgaOjgwGv4XDh40Iw4aFhgOGgYaAgEIFB42ICc8IBIB6jx6ejx5AAQAAP+xA60DUgARAC8APQBcACpAJzg0MgUEAAEBRwADAQNvAAEAAW8AAAIAbwACAmZbWkpILiwdGwQFFCsBHgIGBy4DLwEuAT4BFxY3HgQOAQcGIyInLgE3PgEmLwEmJyY2NzYzMhYTBgcmJzYnJicWFxYXFhMeBA4BBw4BByInLgE3PgIuAycmNjc2MhYBUAsMCBgXCzQ2Og4TIhYmSiNN7QYMHBQICCwlHTAeGSAMFSIWBg8WBwUSGiMTFhsuvwkfCRoOEQ8lPzcFBA6NBRAiFhAKLCgNMB0WFCUcECEkBAgUGAwDExokFDQwAgoiRFpYJS1WNjAICxNISBIRLmwOGFhQeG58NigRFk4gL3pmMUgXBiNKEgkc/nJZVElAYWhkWzJDFRhkAYkJJGBmmJS8VhseAQkSTCZGlHZ6Tk4WByRQEgscAAACAAD/sQNZAwsAEgAiACxAKRAGAAMCAAFHAAQBAQACBABeAAIDAwJSAAICA1gAAwIDTDU0EhwRBQUZKwETIwcGDwEjLgEvAS4BJyMTFTMBERQGByEiJjURNDY3ITIWAczAVEkPEiICCxoQGgoqBlS1SgGNXkP96UNeXkMCF0NeASoBSIocJkcaOB8zFEwP/rjzAjP96EJeAWBBAhhCXgFgAAAAAAIAAP+OAxIDCwAQABUAOUA2FAsGAwJEAAUAAAQFAF4GAQQAAwEEA14AAQICAVIAAQECVgACAQJKAAASEQAQABAVFBERBwUYKwE3IRMhDwEvASMfATM3EyEnAyEDBSUCdwn+EhoBVgxubgdiDcoCyBz+mQn+AxJI/r7+vwIFYv7WgB0dTps3NwEwZQEG/N1aWgAAAAAE////sQNaAwsAFQAfAC8APwBCQD8ABAYHBgQHbQAJAAYECQZgAAcCAQAFBwBeAAUAAQMFAWAAAwgIA1QAAwMIWAAIAwhMPjs1NTUjFDMUJREKBR0rJREjFhUUDgEjIiY1NDcjERQWMyEyNgM0JiIOARYzMjYTNTQmByMiBh0BFBY7ATI2NxEUBgchIiY3ETQ2NyEyFgL4SwtIeklunAtPFA8CVA4UnmaOZAJoRUhknxYQYhAWFhBiEBZhQC79gy1CAUAuAn0tQjYBaiMmR3ZGmGsmI/6WDhQUAThFYmKKYmIBDlwPGAEWEFwRFhaF/YItQAFCLAJ+LUABQgADAAD/swR3A04ADAAsAE8ATUBKAAwABAMMBGANAQMIAQIBAwJgAAEAAAUBAGALAQUKAQYHBQZgAAcJCQdUAAcHCVgACQcJTE5MSkhCQD07OTcmIiMlEiMkJDIOBR0rARQGIyEiJjQ2NyEyFhc0JyEiJjQ2MyEuASIOARcUFyEyHgEGIyEeATMyPgI3FAYHIxYVFA4CJyImJyMiJjQ2OwEmNTQ+AjcyFhczMhYDMBwU/nkUHBwUAYcVGnkN/dwUHBwUAfsxpMSoYgEMAiQVGgEcFP4GMaRhSoZiOs8cFEkJSHyqXYniN2oUHBwUSgpKeqpeieI3aRQcAYIUHBwoGgIeEjAvHCccUF5iqGIwLxwoHE9eOmCI2BQaATAvXax4TgOUeRwoHC8wXap8SAGWeBwABAAA/7ADWQMLABsANgBSAG4ASUBGaTQdAwIDY2JbWlZQS0pCKyYlHhsTEg4RAQJBPQUDAAEDRwcBAwIDbwYBAgECbwUBAQABbwQBAABmbWtgXxknLxgeJwgFGislDwEOAScOASciJic0NjcmNj8BFwcGFBYyPwIDFwcnJiIOAR8BBy8BLgE3LgE1NDYzMhYXNhYBFAYjIiYnBiYvATcXFjI2NC8CNx8BHgEHHgEDFAYHFgYPASc3NjQmIg8BJz8CPgEXPgE3MhYCVVllJGIuCUAoL0IBMiYMGiQHVAYVKToVZVpqB1UHFTooAha+VFplJhgOJzJELypABy9eAedCMCo+CTBoJgZUBxQ6KhURrlWuECQaDCs4ATgrDholB1QHFSo6FL9VWlUQJWYxBkAsL0T7WWYjGgwnNAFELyk+CTBiIwdVBhU6KRRmWQEoB1UHFSo6Fb5VWWYlaDAIQCgvRDgoCxr9iC9ENicQGCYHVQcUKDwUEK5VrhEjYi4GQgJKK0IFMGYlB1UHFDoqFb9VWVURJRoPKjgBRAAAAAIAAP/5BHgDBwAdAFQAU0BQHBQCBwE9AQUHQSYCBAUjAQMEBEcAAgECbwABBwFvCgEHBQdvCAEFCQEEAwUEYAYBAwAAA1QGAQMDAFgAAAMATFNRSkgmJCYjJSgjKTULBR0rAR4BBxQGIyEuATU0NjcmNTQ2NzIXPgEXMh4BBxUUBRQWMzI3JyYnBiMiLgE2MzIeBRcyNjc0JiciBxceARc2MzIWBxQGIyImLwIuAgciBgPsPk4BhF39TV+EPjMHXEE1KyqkZF2cXAH9GF5FTTkaEQglKx8qASwdGC4kJCguQCNEXAFeRFA3EQkUBiUqHS4BKh8YLBIlJxQuPiNEXgGjGXBEW4IGgF09aB4WGEBaASFWagFamlsKB5dEUDgfFAgkJjsmGCQwLCgUAlBCRE4BNhMKGgYkJB0gJhYUKi4YIhwCTgAAAAABAAD/+QPoAmYAYAA0QDFZJiUABAIBAUcGAQQHAQECBAFgBQECAAACVAUBAgIAWAMBAAIATCwvKScoJSwrCAUcKwEUFx4DFxYVFAYjIi4FLwEuAyMiDgEVFBYzMjc2NxcGBzEGIyIuASc0PgIzMh4GFxYzMjY1NC4GJyY1NDYXHgEXMR4CFwcmJzEmIyIGAtEGBRIaGBO1dlMhOiwqHCAQDhQSIjBELTViOHZYYy0fDy8IEEmPUopKATBSbjsxUDowICIWIg41TS1AFiIuMDIoIgQCYj4rMBoGDg4ESA8PDSobJgHJAxQQFhAGBzKHUWwUIDIwRC4lNS06MhY+ZDVZhjUkHVUTFFVYkFE7cFQ0FiI2OkhCUB9wNi0YIBQQDhgiOCkJCT5aAQIMGAYQGAM3GwwMJgAAAAADAAD/sQR3Ar4AFgArADsAcEBtEwEHBC8fAgwKOTQqJBoFAQYDRwcBAEQLAQoHDAcKZQ8NAgwGBgxjAwEAAQBwBQEECAEHCgQHYAkOAgYBAQZUCQ4CBgYBWQIBAQYBTSwsGBcsOyw6ODYyMC4tKSciIB4cFysYKyIjEiIiERAFGisBEyInJiMiByYjIgcGKwETNjMyFzYzMgMyFhcDJiMiByYjIgcDPgI3Mhc2NwMGByYjIgcDPgEzMhc2FwQgV0lHb2x+U1J+bHBHRQNXfY+DVVaCkJdIdFdGX259VFN9bmBFO0RgNHBgYIcedlNUfGJaP0V0QnRcYHECd/06IDNTUzMgAsZHOzv9kyAlAjosT08s/cYYGhIBPT0SAfsDVFcl/fMcHDk8AwAAAAADAAD/zANZAv8AAwAOACoASkBHIgEFAQFHBwkCAQgFCAEFbQYEAgAFAHAAAwACCAMCYAAIAQUIVAAICAVYAAUIBUwAACknISAcGxYUERANDAkGAAMAAxEKBRUrExEjETcUBisBIiY0NjIWAREjETQmIyIGBwYVESM2PQEnMxUjPgM3MhbDuMQ6LgEuODpcOAKLty4wIy4NBrgBAbgBCxgmPCJfdAH1/dcCKaspNjZSNjb+QP7DASg7QiYdERz+y9+KpRtQEhogEAF+AAAJAAD/aANWA1MABwAOACAA/gELARoBJgE5AdwDSkuwClBYQTABJwABAAEACQEfARsBCABzAGkAYABXAA0ABwADAAoABgADARgAmgACAAUABAC+ADAAIwADAAAABQAhAAEACAAAAdYBbAACABAACAD1ANkAAgAHAA4A3QABAAsABwAIAEcbS7ALUFhBMAEnAAEAAQAJAR8BGwEIAHMAaQBgAFcADQAHAAMACgAEAAMBGACaAAIABQAEAL4AMAAjAAMAAAAFACEAAQAIAAAB1gFsAAIAEAAIAPUA2QACAAcADgDdAAEACwAHAAgARxtBMAEnAAEAAQAJAR8BGwEIAHMAaQBgAFcADQAHAAMACgAGAAMBGACaAAIABQAEAL4AMAAjAAMAAAAFACEAAQAIAAAB1gFsAAIAEAAIAPUA2QACAAcADgDdAAEACwAHAAgAR1lZS7AJUFhAagAJDwEPCQFtAAMBBgEDBm0ABgQBBgRrAAQFAQQFawAFAAEFAGsAAAgBAAhrAAgQAQgQawAQDgEQDmsADgcBDgdrAAcLAQcLawwBCxEBCxFrAA8CAQEDDwFgABEKChFUABERClgNAQoRCkwbS7AKUFhAcAAJDwEPCQFtAAIBAwECA20AAwYBAwZrAAYEAQYEawAEBQEEBWsABQABBQBrAAAIAQAIawAIEAEIEGsAEA4BEA5rAA4HAQ4HawAHCwEHC2sMAQsRAQsRawAPAAECDwFgABEKChFUABERClgNAQoRCkwbS7ALUFhAZAAJDwEPCQFtAAMBBAEDBG0GAQQFAQQFawAFAAEFAGsAAAgBAAhrAAgQAQgQawAQDgEQDmsADgcBDgdrAAcLAQcLawwBCxEBCxFrAA8CAQEDDwFgABEKChFUABERClgNAQoRCkwbQGoACQ8BDwkBbQADAQYBAwZtAAYEAQYEawAEBQEEBWsABQABBQBrAAAIAQAIawAIEAEIEGsAEA4BEA5rAA4HAQ4HawAHCwEHC2sMAQsRAQsRawAPAgEBAw8BYAARCgoRVAAREQpYDQEKEQpMWVlZQScByQHIAbkBuAGlAaMBcQFwAVcBVgFTAVIBUQFOAUkBSAEsASsA+wD6APIA8QClAKMAnwCeAIcAhgB3AHYAZwBmAF0AXAA2ADUAEgAFABQrAQYPASI1NDcXBiYHNhcWByIOAxcyNjc0NjQyJzUnJgU0Jzc+Ai8BLgInLgEnFhcWBwYHBi4DLwEuAScuBDYmJy4DNjc2FgcGFjc2PQEuAi8BBhcUIy4BBjU0JiIGBxQeARc+AQciJic0NhcyHgEHDgI1DgEXHgMXFjc+AT8BNjc2Fx4BBgcOAQcOAScmFBcWMz4BPwE2FhUUDwEGDwEOAgcOAiYnJgcGFRQOAhcOAQcGFAcGJyYnJjc2IwcGFxYfARYfAR4BBgceAhc2Jy4BLwE+ARcWNzY3NhYHFAcGFjM3NjU2JjY3NjM0NhYBNiYnJhUWMzIHBjMyFy4GBiMGFhcyNic0Ji8BIh8BFhcUPwE0LwEmIgYWDgEUFj8BNjc0MjYBHgEGFA4CIgYnDgEHDgEnLgMnIyIHIg4CLgEvAS4CJyY2NzYuATY3PgE3PgE3FgcGJyYHBh8BHgEUFgYWFxYfAR4CNz4CJi8BJicmBwYnJjU+Aj8BNj8BNjc2NyYnJjY3NjM2FhceAQcGFxYXHgEXFg4FIy4CLwEmNyYOARcWBwYWNjc+ATc+AS4BJy4BNjceBQFyBgMEAwo3AwgGDgQCxwMCAgQIBAIKAgICAQEBAd0fBAICAgECAQQCAgUqEw0TMBIGFhEIAgoMBQkEBgEIEhAKBgwIFAkgCAQMDhUQBgYKDAcDCgwHDzwKAQUWEBIfEAIEDAIGBQYECAIKDgoKAgIMChYHBAYIDAYODRseARgHEQoBBgYCAgQICygGGB0eBQoOFwoUCjEFCgECAQIFAwQIAQ8sIBcXDAIBEBAICg0sBAEDBAwSAgEDAgMCFBoDCw0LLzQJAhIQBBgGARoWAggBAQIKBhpDShkNDAENBQQLCQcBCgIMCRQmKv6uAgYDBQEBBgIBBgHqAQQMBQQEAgICBxYLBQZkBgMFCAQCCAIFHwELCAoEBAMGBAIGBAUKBgE9Cw4CEggaCBwBFTYPCToVCgwGFBBoFQsZKBQcIFwjOQoYDAQFEgEBBgYCBQcwChEMAQweEhwTBQcKBAMEARICEwwjOA04JA0YGAIKBgtDGyYZBgMBAQoQBQ4KBxEKCz4IBwICHiwWJB46FSAmAgMTEzcfMggFBAoLEA4gEgoODAEHBgEMFggICwsFHjQVISIpHhoGFhETEgIHAQgIDgoOAm0BBQYDBwIIAQgBBgcD8AQKBgkCCAYCBAQCAgEByAoODwcQCAgXCQYWAxs+CwskWkEWAQIYRi4iCA4GBAIjLhAUGSQSBQIQAhwcAQImDQoKBQISFREWDAIEBEcIBQICAyAmIBEIGg4BAgsBEAsMEgEYFAIJDg4BCBACBAwKBAIBCQEGAwcEBggDAgYIAQMSAgsFBAEECA0BBgUaAwQEAQEDAgECAQQCAQgiDg0iEgUCBA4iHCYQA14gCjgFDgwRJA8QCgMkOQYJCw0mKgkaFgIIIB4YDSYFCAMDAwYFHQkJKBUIGg0mDRArIREMOjIOChUSBgHECQ4CAQUDCQtsBAQCBAYCBgIJHgMKfQYKAQIEAQIPAgOEAQEICAgGBwYEBQIFAwIBAv0WBg4OChAEEhICCygQCQQKBRAOCAECEBIOASIHCgIICAcMMgUJHBIYAwYEBAoUEikSCwMBBwgYCgcGDA8mEQUEBwsDEggCAxgeJAsUah0pEgYOCQwQGhoLKB0OIhQLTx0/bjNEGAwBEg4XWiU1Qj87IXQwHCgWAhIWEAEEDAIMCgEUCC4fJ0YkKAITHBIPChQUDAcGKiYIEhwSDAoEAAAAAQAA//kD2gLDABQAKUAmDgEBAUYEAgIAAQBwAAUBAQVUAAUFAVgDAQEFAUwiERERIxEGBRorAQMjEzYmKwEDIxMjAyMTJyEyHgIDzly6YwceH19yunKgcrpyVQLIOGJDGAGj/lYB0B8l/ewCFP3sAhS2LFNqAAAABAAA/7EDWQMLAA8APgBTAGMAWUBWFwEBAjkAAgABTgEEAANHAA0CDW8JAwICAQJvCwgGAwQACgAECm0HBQIBAAAEAQBgAAoMDApUAAoKDFgADAoMTGJfWldST0xJRUI0JTQlNDI1JiQOBR0rARUUBicjIiY9ATQ2NzMyFgU1NCYrASIHJisBIgYdARQ7ATI9ATQ2NzMyFh0BFDsBMj0BNDY3MzIWBxUUOwEyJTU0JisBIgYXFRQ7ATI9ARY7ATI2ExEUBiMhIiY1ETQ2MyEyFgLcEA1xDRAQDXEODv7vJB5KJg8QJkkdJAsfDBANNQ0QCx8MEA02DRABDR4MAUkmHZMdJgEMHwsSI2oeJEdMNf2qNkxMNgJWNUwBfD8OEAEODz8ODgEQjYseJB0dJB6LDAyADg4BEA2ADAyADg4BEA2ADEFWHiQkHuQMDGQXJAF1/ao2TEw2AlY2TEwAAgAA/7ED6ANSABIAGwAItRkUAgACLSsBEQcuAic0PgE3FQ4BFRQWFxEFFyU3Jic1FhcCXph/0HYBcMR4eZysgwINFf7bUkJamnIDUvynSAxakFBOiloQYBV+T1WAEQL3+9k/LycQYBNFAAAAAf///2oDDgNSAGwAVEBRV09OPDowJQcDBGQjFQoEAAYCRx0BBgFGRAEERQAEAwRvAAMFA28ABQYFbwAGAAACBgBgAAIBAQJUAAICAVgAAQIBTGtqYF9WVSgnIycUBwUXKyUOAyIuAi8BDgEHIiY+ATMyNjcOAi4DJz4BHgIXNjciDgEvAS4EJz4BHgUfATY1Jy4ENjceBA4BDwIVNz4FFw4DDwEGJgYvAQYHNj8BPgIeAQMOETI0Ojg0LCIICj/EdQoQAgwMYaY5FCg0MjYwLhNAcEpCIA8eDwQMKBMuGywyIhoDJ0Y4MCIcEg4BAwYMCCYgHAoYGyk8IhQCAgwFCQQFAxweMDZIJgEWIiwXMBkmJgcJDRwDBxwVLEJCTustQCQQCg4QBQaAkgEOFg54aAgKBAYaKEgtGwoSLCoZSVkCAgIFAxQcLD4oEAgIGh4mIB4HCUQpCAUoKEA+UCUOKC4wNCwqDRgIRAoGJB4gEAIPK0gsJAcOBwQCAwJSTAQGFxEYGAIYAAADAAD/sQO+A1IAEQAzAFIAUUBOMgEACAkBAQBEAQcCIgEDBARHAAcCBAIHBG0ACAAAAQgAYAABAAYFAQZgAAUAAgcFAmAABAMDBFQABAQDWAADBANMRzU5NSQ1NygxCQUdKwE0KwEiBg8BBhUUFhczMj4CBRQHBisBIgYPAQ4BByMiJjU0NzMyNj8BPgE3MzI2NTQnFgcUBwYrASIGDwEOASsBIiY1NDcTPgE7ATIeBQJthScSHgQjARIOHSdCPCIBUXt63CISHgQoBSQVdxEYB1QTIgQpBCISItryHWdne3ncIhIeBCkEJBV3EhgCpwQmE/gmQEY4NCQSAllZGBGaAwYOEAEOIDwtlFtZGBKwFBwBGBAGHhoTsBMaAbKSSCszIJRbWhgSsBQcFhEFBgLWFRwEDhIoKkoAAAAACgAA/28EWgNSAIMAvQDLAM8A3QDjAOcA6ADsAO4BIUA8uaQCCguVfn1zb24GBgng3gIHBt+DWAMAB80BAQBgQhcDBQHPziMgBAgF2QEMDufmDgoEDQwJR7CdAgtFS7AoUFhAWAALCgtvAAoJCm8ACQYJbw8BBgcGbwAHAAdvAAUBCAEFCG0AAgQDBAIDbQADDgQDDmsQAQ4MDA5jAAAAAQUAAWAACAAEAggEYAAMDQ0MVAAMDA1ZAA0MDU0bQFkACwoLbwAKCQpvAAkGCW8PAQYHBm8ABwAHbwAFAQgBBQhtAAIEAwQCA20AAw4EAw5rEAEODAQODGsAAAABBQABYAAIAAQCCARgAAwNDQxUAAwMDVkADQwNTVlAJOXk4+Ld28rIwcChoJSQd3RlY1tZVlRFQzw6LSsqKRUUEBEFFSsBNh4DFx4CFw4CBy4FIw8BFhceBB8BFhQfARQOAgcmBiMiJyY1NDc+AicmBw4BIyIvASYnJicEIyIuATY3JSY0Nj8BNjI3MjYzMhYXNjMyFhQGDwEVBhYzMjY1NC4CNzQ3JzY1NCc2MzIeBRc3DgMHNy4DLwImBi8CJgcjIgc+Aj8BPgE3HgI7ARUXNj8BPgc/AQYHDgEPAQYHHgEVFAM+ATMyHgMXBiMiJwM3FwcXFhQOAQ8BBiMnPgE/AQMHJz4BMhMzFwcBMRUHPwICqipMODgmFxMyIiYaRFYVGSASEh4yLAUDAgUDGAYOBgQGAgIBBAQKARRIExYSAQEBIh4BDQsUVCIOHDwgDgQL/vMSCQwBCgcBDwQGBgsFEAICDgMIDgRbBQoOCghmAVwNGlAaHhwBBiYYAy4iGR4YDAoICgkbARYaEgEiAgoECAEFBAQCBAgLBwUoRjMJFigQGgokBgcSEA4GDYlGHA0UEg4ODA4QCQMBFyyMZTMMCgIYihZmHwUQDhAKA0NFIiSSGzwo6AIUHhAdDQUECy4RIfc1BAYYEnYRBhcB8AIBAQEBTAEaJkQ0Kh88HCQRHiQIFFhgaFQ2AQIDBQMUBBIECg8FGAsSDyIYKgkBDAYJESkNByAiCwEOHjQkTSkNAw4+DBEOATsIDAgCBAIDCBIKFQwSDAIWCQ9mWhsUEgQIDwkKCxgpDhIJAgYKEhIkDw4XFgIECngDCgYIAgQEBAIEAgIBARgREhAMFAguBQUaDioBNTUWChYMGgoeDCoJBR4wXG4ZCQIGCiADBv30DhgQIBgiARkGAcEHYxuqCAQKBAMFAhgBCAECAV8LCQEG/pkuBwN0AgEBAgEAAAABAAD/sQLKA1IASgBFQEIjAQUCEwEBAwJHHAEBRAACBAUEAgVtAAUDBAUDawAAAAQCAARgAAMBAQNUAAMDAVgAAQMBTEVEOzkxLyknKCUGBRYrETQ+AzcyHgEVFA4DJyImJwcOBQ8BJyY1NDY/ASY1NDYzMhYVFAYeATMyPgQ3NCYjIgYVFB4CFRQGIycuAypKYG45WZheFDBAYjgmShEPCggOEBIiEgcGCBgZHRI6LSImMgEyJB80JBoQBgF6Y2+WDhAOEA0JHSwYDAIFPGpQOhwBSo5ZNmZgRi4CJB8/KRg4FjAoHAMGWBEzgGFxJDouUi4iJYpHLhwwOkA8GmBskHAYLhoaBA8yAQksPjoAAAEAAP9qA98DUgBnAEBAPWBaGggEAQBUMgIFATYBAwUDRwAAAQBvAAEFAW8ABQMFbwADAgNvAAIEAm8ABARmUlFIRUJBPDonJiwGBRUrEyY1NDY3JjY3NDY3NjMyFx4GHwEWFRQGHQEUFiMeAQcUBiMiLgUjBwYHHgIXDgEHBiMiLgEvAS4BBw4BIyIuAzc0Njc+ATMyNzY1Jy4BLwEiBw4BByMiJicmNTSXBQwIAQoIZkZOZ0tKGy4iGhYODgUBHwoEASsyARYUBQwIDgQKAQEDISkMLh4FAQIDJIUdQC4jDQgkBBdgLhQmQi4mAQwRBiAMAgYBARtCCAMCBQooFwECAgINAZALEgsiCAwiB06mIiUfCx4iKig2LiADLiUIHgYCAgJAcDwYQAgMEA4QAgJWJwsUGhgCDgM2CgwLBAICARkWAggOIBMXFBIBDAIBAQIGaCQBCxckAwQBHxmaAAAIAAD/agTXA1MAFQAeACcAMABBAEoAUwCHAV1AFoB/dQMNDINuAggPRwEFCEkvAgQFBEdLsAlQWEBWABESDBIRDG0DAQEEAgQBAm0AEgAMDRIMYAANABMQDRNgFAEQAAkPEAlgFQEPCwEIBQ8IYAcBBQYBBAEFBGAAAgAACgIAYAAKDg4KVAAKCg5YAA4KDkwbS7AKUFhAXAAREgwSEQxtABATFBQQZQMBAQQCBAECbQASAAwNEgxgAA0AExANE2AAFAAJDxQJYRUBDwsBCAUPCGAHAQUGAQQBBQRgAAIAAAoCAGAACg4OClQACgoOWAAOCg5MG0BWABESDBIRDG0DAQEEAgQBAm0AEgAMDRIMYAANABMQDRNgFAEQAAkPEAlgFQEPCwEIBQ8IYAcBBQYBBAEFBGAAAgAACgIAYAAKDg4KVAAKCg5YAA4KDkxZWUAmhoSCgX18eXd0cnBvbWtfXlJRTk1GRD49NjUjExQTFBMUFCQWBR0rJRQHDgEjIicmNDYzMhceAjY3NjIWJRQGIiY+AhYFFAYiJjQ+ARYlJiMiBhcUFzYFNCcuAQ4BBwYUFx4BPgE3NhM0JiMiBxYXNgM0LgEGHgEyNhMUBgcWFRQGBw4BIiYnLgE1NDcuATU0NjMyFzY/ATYzMhc+ARcyFg4BIiY1JwcWFzYzMhYDSgcdajmMNQYMCwgIIUpoTCAJEgz+2TBEMgEwRi4BaDBDMjJCMv1eFhslNgEeHgPOi0e2vLZJiopIuLq4RotBNCUcGE4dIlAmNigBJjcmfyYeA1pHTsLIxE5IWAQeIlA4MiaU0FEFEQ3JDjYjLkICPl5CvUbDjSgzOU41CAkhGjsJEQ4HGxICFhkHDtEiMDBEMAI0ICIwMEQwAjSEDzQlKBtOpnxcLzACLDFc+FwvMAIsMVwBFyU0EEBPGwGkGyYBKDUmJv6iJEASFBFOgi8zMjIzL4JOFBQSPiM4UCJfBP8QMx8mAUJcQkItLdwJWyNQAAMAAP+xA1sDAwAIABIAHAAUQBEZFQ0JBgMGAEUAAABmEQEFFSsFBiInPgE3HgEDERQGByY1ND4BARQHLgEnER4CAnhf22BNbhITbsiOcWVeogJZZXKMAWSiYBo1NTCMT1CKAuz+8YzoN3icaLZ2/myceDfojAEPEXi0AAAFAAD/xgR3AvcADwAfAC8APwBcAGFAXlEBAAkIAQIAGAEEAigBBgQwIBAABAEGBUcAAgAEAAIEbQAEBgAEBmsACgAAAgoAYAAJAAYBCQZgBwUDAwEICAFUBwUDAwEBCFgACAEITFVTUE40JiYmNSYmJjMLBR0rJRE0JisBIgYHERQWNzMyNicRNCYHIyIGBxEUFjczMjYnNTQmKwEiBgcVFBY3MzI2JzU0JicjIgYdARQWNzMyNiUUBiMhIiY1NDY3JjU0NjMyFz4BFzIeARUUBx4BA0UQDDQLEAESCjQLEp8SCjkLEAESCjkLEKISCjkLEAESCjkLEKISCjkLEBALOQsQAxeEXP1JXIRGOwZaPzksGaZqU4xSB0tgVQGZDBAQDP5nCxIBEAwBKAsSARAM/tgLEgEQDO8MEBAM7wsSARAMygsQARIKygsSARBdXISEXEFuHBMWP1omZoQBUoxUJR8SegAAAAAnAAD/jQNZA1IABAAJAA0AEQAVABkAHQAhACUAKQAtADEANQA5AD0AQQBFAEkATQBRAFUAWQBdAGEAZwBrAG8AcwB3AHsAfwCFAIkAjQCRAJUAmQCjANADdUA2xgFAB8QBCQavAQsIsQE+PT8jAgw6BUdBQD08Ozk4NzU0MzEwLy0sKykoJyUkCQgFBAMCHAxES7AMUFhAu1YvAh4gBSAeZQA7BQRAO2UAAAACDwACXk4dTRtMGUsXShVJE0gRRw8PHBoYFhQSEAcOAw8OXkEBAwABHwMBXi5VLFQqUyhSJlEkUCINHy0rKSclIyFPCCAeHyBeMEICBVcxAgQHBQReMkMCB1gzAgYJBwZeAEAAPzxAP2E0RAIJWTUCCAsJCF4APAA9Pjw9YDZFAgtaNwIKDQsKXjhGAg06DA1SAD5cAToMPjpgOEYCDQ0MVls5AgwNDEobS7AdUFhAvFYvAh4gBSAeZQA7BQQFOwRtAAAAAg8AAl5OHU0bTBlLF0oVSRNIEUcPDxwaGBYUEhAHDgMPDl5BAQMAAR8DAV4uVSxUKlMoUiZRJFAiDR8tKyknJSMhTwggHh8gXjBCAgVXMQIEBwUEXjJDAgdYMwIGCQcGXgBAAD88QD9hNEQCCVk1AggLCQheADwAPT48PWA2RQILWjcCCg0LCl44RgINOgwNUgA+XAE6DD46YDhGAg0NDFZbOQIMDQxKG0C9Vi8CHiAFIB4FbQA7BQQFOwRtAAAAAg8AAl5OHU0bTBlLF0oVSRNIEUcPDxwaGBYUEhAHDgMPDl5BAQMAAR8DAV4uVSxUKlMoUiZRJFAiDR8tKyknJSMhTwggHh8gXjBCAgVXMQIEBwUEXjJDAgdYMwIGCQcGXgBAAD88QD9hNEQCCVk1AggLCQheADwAPT48PWA2RQILWjcCCg0LCl44RgINOgwNUgA+XAE6DD46YDhGAg0NDFZbOQIMDQxKWVlA8pualpaSko6OioqGhoCAfHx4eHR0cHBsbGhoYmJeXlpaVlZSUk5OSkpGRkJCHh4aGhYWEhIODgoKwsG8u7Syrqypp6CemqObo5aZlpmYl5KVkpWUk46RjpGQj4qNio2Mi4aJhomIh4CFgIWEg4KBfH98f359eHt4e3p5dHd0d3Z1cHNwc3JxbG9sb25taGtoa2ppYmdiZ2ZlZGNeYV5hYF9aXVpdXFtWWVZZWFdSVVJVVFNOUU5RUE9KTUpNTEtGSUZJSEdCRUJFREMeIR4hIB8aHRodHBsWGRYZGBcSFRIVFBMOEQ4REA8KDQoNFBUQXQUXKxEhEQUtAREhEQUBNSEVFxUjNRcVIzUXFSM1FxUjNRcVIzUXNxcHFzcXBxc3FwcXNxcHPwEXBz8BFwc/ARcHPwEXBwEVIzUzFSM1MxUjNTMVIzUzFSM1MxUjNTMVIzUzFSM1BRUjNTMVNxUjNTMVIzUzFSM1MxUjNTMVIzUzFSM1FzUjNTMVBzUzFQc1MxUHNTMVBzUzFQc1MxUlIi4BNhcyFhQGJxQeAjIWFRQjIicjBxYzMj4CJzQuASImNDY/ATIWFzM3JyYvASYHIg4CA1n+T/5YAyH9FwFxAXj9Fy0VFRUVFRUVFRUkCDsJEQk6CBEIOwkSCDoILDoJO0M7CDtEOwg7QzsIOv3pQJpAmkCaP5pAmkCaQJo//ZwVQVpAmkCaP5pAmkCaQIYrQBUVFRUVFRUVFRX+n0hmAWhHSWZmpRYiJCQUPjYPARImNRAeIBQBHi4qIBgKFxMqBwIRIwcGGAgFECAcFANS/Pe8vCUCBP38pQLhcHCmQEBTQEBSQUFTQEBTQEBPExsSCBMaEwcTGhMHEhoTExoSGzUaExo0GhMaNBsTGgKwFBQUFBQUFBQUFBQUFBQUFL4sQBQUFBQUFBQUFBQUFBQUQCwUQFJAQFNAQFNBQVJAQFNAQBRmkGgBZpFm1BQWBgIKDBwdIxgGDBgSGhoEBBgOAQIMDSAOAwEFAgIGDBoAAAMAAP+qBHcDEgAIABIALAAvQCwHAQUGBW8ABgIBAAEGAGADAQEEBAFUAwEBAQRYAAQBBEwzEzU1FBQTEggFHCsBNCYiBhQeATYlNCYiBgcUHgE2ExEUBgchIiYnETQ2NzMyFh0BITU0NjczMhYB4lp8WFh8WgHhWH5WAlp6XLIkGPwBGSIBJBjxGCQBpSQY8RkiARI/WFh+VgRePD5YWD4/WAJcAgD9EBkiASQYAvAZIgEkGFpaGSIBJAAAAgAAAAAEdwKtAAAAWQBfQFxYQAIHAAFHAAgHBgcIBm0ACgAJBQoJYAAFAAIABQJgCwEAAAcIAAdgAAYDAQZUAAMBAQNUAAMDAVgEAQEDAUwCAVRSR0U+PTs5NTMtKyYlGBYSEAgGAVkCWQwFFCsBFzIWFxQGByIuByMiBhcUFjMyNj8BPgEXMhYVFAcOASIuASc0NjcyHgU3MjY1NCYjIgYnIiYnNDY1NCYjIgYPAQYHIiY0Nz4BMzIWFRQHNgMekVN0AXpYL1ZEQDo6PkZSL1ZuAXRZOHgwCwkQBAgMIjiUkn5KAZ5zQ3ZaTk5GYi85Skg1ETgKDBABCnhZIToSHw0GCAwOIWI1ao4CIAINcm5SV3QBIDJESExCNB5mVVhoKiIKCAwBDAcOHTI8QnZLc5YBME5cYEwyAUQ5NUgWARAMCiwLWHQUDRYJAgwTDyYojGoUEQkAAAACAAD/sQNZAwsAPQBdAGZAY1MBAgkMAQEATAEEAVwBAwRDAQcFBUcACAkIbwAAAgECAAFtAAEEAgEEawAEAwIEA2sAAwUCAwVrAAYHBnAACQACAAkCYAAFBwcFVAAFBQdYAAcFB0xWVCoiJiQkLyUlLQoFHSsBNC4DLwEuAyc0MzIWHwEeATMyNjU0LgEHIg4CBxQeAh8BFhcWFAYnIi4DIyIGFRQWFzI+AhcUBiMiJwYjIi4CJzQ3JjU0NjMyFzYzMh4CFxQHFgKPFiAyKhxTCBYMBgFQGCYLFQoaDhogQF42Jkg+JAEULCwkUTMMEi4jHSweFCAOHByIXilKQCLMflhJOisoUJJqPAEJLX5YSTorKU+SajwBCS0BARwuHhgOBhQCCAoOCSsMChMJDiQZHzAcARIiPikiNCAWBxQMCAssHgESGhgSIhg0SAEUKEBPWX4tCT5qkFEpKzpIWX4tCT5qkFEpKzoAAAAAAgAA/7EDoQNSAFIAVgBUQFFWVU9FOzowBwAFUCYCBABUJRsREAYGAQQDRwAGBQZvBwEFAAVvCAEABABvAAQBBG8DAQECAW8AAgJmAQBJR0JANzUqKB8dGBYNCwBSAVIJBRQrATIWFxQPARcWFRQGIyImLwEHFxYVFAYjIiYvAQcGIyImNTQ2PwEnBwYjIiY1NDY/AScmNTQ2MzIWHwE3JyY1NDYzMhYfATc2MzIWFRQGDwEXNzYFNycHA1AiLgE0YB8EMCAaLAgerR8ELiIbKggfVRELIi4gGFc7Vw4NIS4eGVgeBC4iGiwHHq0eBC4iGiwIHVsLDSEwIhlXOlwN/lKtO60BoS4hNhMhXQwOITAeGVw7Ww4NITAeGlseBSwjGioJHa8eBS4hGioJHlgODSEwIBhZO1kNDSEwHhlaHwMsIRkqBx6xIASSOrA8AAAABAAA/18D5gNTAAkAEwA3AF8ARUBCXFMdFAQAAQFHTURDOi0FBUQIBwYDBQAFcAAJAAQBCQRgAwEBAAABVAMBAQEAWAIBAAEATFlWETYiGTUUFBQSCgUdKwEUDgEmJzQ2MhYFFA4BJic0NjIWFxE0JgchIgYHERYfAR4CNhY2FTIXFhcWFzYfARY2Mj4DNwYHFgcGBwYnJjcvAQcWBwYnJicmNyYnJjYfARE0NhchMhYHETc2FgHnRmRGAUhiSAEXRmRGAUhjRn4kLP2ULyABGBotEzQcMg4yJg8DAg8TBD5GExYmHigiKm5EjC88JEI6KzACARoBAjAsOkIkOy+MRA4YFQ00JgK9JTYBDBUYAbUuQgJGLC9CQi8uQgFELS9CQpMBdDAqASYz/ogNCRAHBgYCBAYBDwQBDg8zAgMBBAoEEgwQUzmfZT8TEhocQLYGvEAcGhIUP2WeOVMVHhAIAYMoOgE4Kf59CA8cAAcAAP9qAxEDUgADAA0AEQAVABkAHQAhAE1AShQQAgEDAUchHx0cGxkYFxUTCgNFBwUCAwEDbwYBAQAABAEAXgAEAgIEUgAEBAJWAAIEAkoEBAAABA0EDQwLCgkIBgADAAMRCAUVKyUVBTUlERUhJxEzESERDQEHJRMFByUTBQclGwEHAyUTBwMCBv51AhH9iBREAgX+PgGIB/53LQF+Fv6DcAFUK/6s9N5F3gFCRFRDRFQBVcH+eRQBAZr+pwFZMSRUJAEFZ1FmARTJSMkBAf66MAFGgv57DgGEAAAEAAD/sQPoAwsACAAdACYAPQBdQFo5AAIAATMBBQA0AQYIMhgOAwMCBEcAAQQABAEAbQAABQQABWsACQAEAQkEYAAFAAYCBQZgAAgAAgMIAmAAAwcHA1QAAwMHWAAHAwdMPDs2IxQTFC0kExIKBR0rARQGIiY+ATIWATQmIyIHFx4BBw4BJy4BJx4BMzI2ATQmIgYUFjI2NxQGIwcOASMiJi8BNRc2MzIXNz4BMhYDc1BwUgRKeEj+VlI5Dw86KyQSEVQrDC4LEkIoOlAB0GSNZGSNZFSWaPQGbkhEaA6A2Sw1BwyfAZTSlAINOFBQcFBQ/io6UgQXEVYpKyQSBBIFIihQAdlGZGSNZGRHapSySGRWQDPwWBsB42iUlgAAAAACAAD/xQQvAvgAHAAtAERAQRwbAAMCACcmJQMDAgJHBQECAAMAAgNtAAQAAAIEAGAAAwcBA1QABwEBB1QABwcBWAYBAQcBTBgTFRUTExUTCAUcKwE1NCYOARURFAYiJj0BMxUUFj4BNRE0Nh4BFxUHFzMVFAYiJj0BFzcVFBY+AScCUSIuIozHjLciLiKMxYwBbd63jMaMSW0gMCIBAcVCFyICHhn+qmKKjGOVkhgiAh4aAVpfiAGIYEwgWpVjjIpjliIglxciAh4ZAAACAAD/agKrA1IAHgBKADlANgUBAAIBRwABAwFwAAYABQIGBWAAAgAABAIAYAAEAwMEVAAEBANYAAMEA0xIRhcnJR4oIgcFGisBFAYHIicGBwYTFgYHIyImJyY+Azc2NyY1NDYyFhcUDgEnIicuAT4BFxYzMj4CLgQOAgcUFxYOASYnJjU0PgI3Mh4BAdZALCEdIh6KGQEQCwMLEAIHChgkKBYiJwlAWEDUVphXJCUMDAUUDBwgNmRGLAIoSmBwYEooAR0FBhYWBiQ0VnpBWJZYAhMtPgEUJizP/vANEgEODEaIamZIIjIqExgsQEAyWJZYAQgDFBcMAQgsRmRsYkooAixGZjRAOgsWDAgLRFBCeFgyAViUAAAAAwAA/7EDWgMLAA8AHwAvAEFAPiABAAUZEQEDAwAJAQEDKAEEAQRHAAMAAQADAW0ABQIBAAMFAGAAAQQEAVQAAQEEWAAEAQRMNTYmJiYjBgUaKyURNCYjISIGFREUFjMhMjYlETQmIyEiBhURFBYzITI2ExEUBiMhIiYnETQ2MyEyFgGJCgj+9AgKCggBDAgKAXcKCP70CAoKCAEMCApZFBD87w8UARYOAxEPFmQCOwgKCgj9xQgKCt4BZQgKCgj+mwgKCgG1/O4OFhYOAxIOFhYAAAABAAD/sAI7A1IAIgA0QDENAQEDAQEABQJHAAIDAm8AAwQBAQUDAV4ABQAABVQABQUAWAAABQBMJRERKRYjBgUaKyUXDgEjBi4DJxEjNT4ENz4BOwEVMxUjERQeAjc2Ag8sDGIyOmI8LhABXihAJhoMAgEEAoi6ugYUJBssbIQTJAEgMkRCIQEweA4yMkAuGgME7Yz+3xEeHBIBAQAEAAD/sQOwA1IAAwAHAA8AGQBpQGYYAQEEEQkCBQAOAQcFA0cACAcIcA4BCgAEAQoEXgwDCwMBAgEABQEAXg0GAgUHBwVSDQYCBQUHVgkBBwUHShAQCAgEBAAAEBkQGRcWFRQTEggPCA8NDAsKBAcEBwYFAAMAAxEPBRUrARUjNSEVIzUTNxEhETMVNwERByMHIzUjETcB9FEBL1FRjf1mtnkBvPK2eXnePQJg8vLy8v5YjQG8/bd5eQKa/cvyenoChqEAAQAA//cDiALDAC8ATUBKLiwqIAIFBQYZAQQFFhICAwQLAQECBEcABgUGbwAFBAVvAAQDBG8AAwIDbwACAQJvAAEAAAFUAAEBAFgAAAEATCQWFiMRIigHBRsrAQYHFRQOAyciJxYzMjcuAScWMzI3LgE9ARYXLgE0Nx4BFyY1NDY3Mhc2NwYHNgOIJTUqVnioYZd9Exh+YjtcEhMPGBg/UiYsJSwZRMBwBWpKTzU9NRQ7NAJuNicXSZCGZEACUQJNAUY2AwYNYkICFQIZTmAqU2QFFRRLaAE5DCBAJAYAAAABAAD/pQNDA1MANABGQEMpAQMBAAEFAxkBAgAFA0cXAQBEAAEEAwQBA20AAwUEAwVrAAIABAECBGAABQAABVQABQUAWAAABQBMJBclHB4SBgUaKwEVBiMOAgcGJy4GJzMeAxc2Ny4BNTQ2HgEVFA8BBiIuASc2NTQmIgYVFBYzMgNDODYkcFwZLS4PJDw2QjQyDp4OMkJGK15CT1p0x2ogCwcmICQKESA6JHZaIgGFbw1MlloPGRsJHkBQfJTMc3nKmG42XoUopGhrigF2a1lGAgEGFhI6LTAyNjRneAAAAAH////3BDsCXQCGADJAL3RWAgMCJQEAAwJHAAQCBG8FAQIDAm8AAwADbwEBAABmg4FjYU5NPz0sKhYUBgUUKwEWBwYHBgcGFxYXMxUXFh8BHgEOASMHBiYvAS4DByIOAxUUBg8BBgcjBi4CLwEuBCcmND8BNjM3HgEfARYXFh8CHgMyPwE+AT8BNicuAS8BJicmNzY3NhcWFx4CFBYGHQEHBh8BHgEfARY+Ajc2Nz4BPwI2Fzc2FhcELg1hDRcsBgoRCiQBAU8cBAICAhoUjw0kCwsRLCAkDgEGDgoIBAICChRAKFJCMBAOBRQ8Ok4iBAICCReZBwwDAwkECw8XCRAeGBYQBwMCCgIFAwMBCAMEDiEICwkMHWguHQwOCgQEAQEBAgEKCAkFFBYkFCEbAgYDAgsIA6AWHAMCMCSAEh43EhcWDCIBAUkyBwQWEA4DAgoIBgwwJhwGBAwUJhkIDgMDCwEDGCIoDA4FGExejFIJDAMDCwEBBgECBgwcHi0QIjAcEAMDAhQQLh4nFyQIBhMFAgwKBw4BAQYDChAUIBwaLhcRChYMFAQCAQ4YNCI6QwYIAgIDAgIBAwgGAAYAAP+NBHcDMAAIABQAHQApAEYAWABoQGUkDwIDAj0yAgkDTEo8AwsJA0dLAQtEAAoACm8EAQABAG8FAQEIAW8ACAwIbwcBAwIJAgMJbQAJCwIJC2sACwtuAAwCAgxUAAwMAlgGAQIMAkxWVE9NREI1MyMVJBMUJCQTEg0FHSsBNCYiDgEWMjYBNCYHIgYHFBYXMjYDNCYiBhQWMjYBNCYHIgYHFBYXMjYnJiMiDgEXFBcGIyImLwEuASMHNyY1ND4BFzIeAQEUBgcXJwYjIi4BND4BNzIeAQFEHC8kASYuHAGeHBYQGAEaDxYcgxwvJCQvHAFiHhUPGAEaDhYclBEWXp5cAQ0UEg8aEhkHLgWNKKJsvG1irnYBXExCH29UJl6eXFyeXlqeYAJRFxweKxwa/v0PGgEaDhAYARgBLBccHiscGv79DxoBGg4QGAEY7gNWlFYsKQICAwQBCkZ5cqBenlwBSIT+d0F2MWU8FE6InopKA1CGAAADAAD/rgNaAw4AKgA9AFEAbkBrOgUCAQRLPDsDBQFJAQgFA0dKAQhEAwECBgAGAgBtAAQAAQAEAW0LAQcABgIHBmAJAQAAAQUAAWAKAQUICAVUCgEFBQhYAAgFCEw/PiwrAQBIRj5RP1E0Mys9LD0pKBkXFRQKCAAqASoMBRQrATIWFxYVFA4BIyInLgEnJjc1Njc2MzIWMzIWFx4BFRQGBxQXFhcWFxYyNgMyPgI0LgIOAwcUFwc3FhMyHgIOAyciJwc3JjU0PgICJgdeAwESPhogSjdQKikBAicODwQMBQsIBAUcJgEDEyYfNQcOLGtHgl44OF6CjoBgNgFDLIdYaFaccEQCQHSYWGxf6Uw8QnKaATIwBgIGEi4eIxlSPjwwBTImDAIGDQtMBAsqBQMFKSMeGwQ2/tk4XISMhFw6AjZggEhxXIIrOgMDRG6gpqBsSAI1S+JjdlaadD4AAAAAB//+/8YD8gL7AAkAEwAdACsATwBiAHcAGUAWQgEAAQFHAAEAAW8AAABmRUQyMQIFFCslNi4BBgcGHgE2NzYuAQYHBhcWNhcOAS4BPgEXHgE3LgIHDgEXHgI3PgE3FA4DLgM3NDY3PgEXFgcGHgE/ATYyFgcOAR4BFx4CAx4BBw4BLgE3NiYHBi4BNjc2FjceAQcOAS4BNzYuAgcGLgE2NzYWAXkLCicsCw0KJi5ABQYOEgMJEQgQZRl+eiw0dDs+NpQFWJJQfKQIBVqOUn2ipShSapKcmHRMAk5HXsIoJBkCBAYFC054MhkBBAoEByA0JCgXDgoFGBkOBQswJA0YBRAMIkJ8MB4XBRweDgQQFEZgMBAaCBIQRIiGEigQEBETJhQSVQcQBQYHEggCBjU5NCZoaDQQEGQhNVIoCA2EUjVSKAgNhE8mTkw2KAYgRmQ9QJJHXkooJFEIBgIBAyFFQAgGCAICCiA8ATobRCAMDgoYDSM0BgMOHBYDBxRBNo4/DxAMGhAuZE0cCQMSHhwCDigAAAAEAAD/agOhAwsAAwAHAAsADwAxQC4PDAcEBAFFCgkCAQQARAMBAQABbwUCBAMAAGYICAAADg0ICwgLBgUAAwADBgUUKwERJREBESERARElEQERIREBff6DAX3+gwOh/gUB+/4FASH+lDUBNwGe/pEBO/6W/klGAXEB6v5FAXUAAAb//v9qA+oDUgAFAD0ARQBPAGAAcQBoQGUyFwIAA0tFQSEgHw8OAwIKBAACRwADAgACAwBtAAQABwAEB20JAQUACAIFCGAAAgEBAAQCAGAKAQcGBgdUCgEHBwZYAAYHBkxiYVFQamlhcWJxWVhQYFFgREIwLiwqKCYWFAsFFCsTNDcTLgElFA8BDgIPAQM3PgEmJwciJyIOARQWMx8BCwE3PgEmJwcjPgEzMhYXIyIGBxQfAR4CHwEWFRYFExQXBiMiJwEWFRQGBxM2NTQBMh4DDgIiLgI+AxMyPgI0LgIiDgIUHgJHJc1thgLQAgUDCAwDK5sxCwgMCnIqRwYKAgoGLENenDELCAwJcxs6vm5SljoGHygBAQIBCAIGDwck/uWFAkZIPjsB8TV0YoQg/oVmuIhMBFSAwMTAgFQETIi4ZmGwgExMgLDCsIBMTICwAV5bVP3PNdCTCwsbEBIwCI8BzQQBFA4BBgYGDAgKBLf+5wHQBAEUDgEGWmg6NywfBwcMBRAGChkLAjx1/pcEAxgSAmlhbXXEOgF7XjwXATtQhLzIvIRQUIS8yLyEUPwvTICwwrCATEyAsMKwgEwAAAAC//7/sQMVA0wAEgAjACVAIh4WCQMAAQFHAAMBA28AAQABbwAAAgBvAAICZjQ4ODMEBRgrAQYHBisBIiY/ATIvASY2OwEyFyUWBwETFgYrASInAwE2OwEyAU0Fig8WhQwKBY0BAVoHDAyGFg8CHQYG/tm8BgsNhRcOvQEoDhaHDAHeCvUZEgv6AZsNEBnHCQz99/6oCxIZAVwCDRkAAAAABQAA/2UDLANZABUAKAA8AEoAYQAoQCVhAQABAUdIAQFFCgEARAABAAABVAABAQBYAAABAEwjIhwaAgUUKyUVFAcGBwYmJyYnNDc+ATcyNz4BHgEnBg8BBiMmJyYnJj4BMzIfAR4BBQ4BBwYnJi8BJjY3NhcyHwEWFxYBFgYnAyY3PgEXFh8BFgUWBwYHBgc1BiYnJjcyPwE2NzYXHgEXAa8DBxUfjhMIAgIDIFUBIQgcGw5TARxDmQoTCwYDBQoYEwhpbw0OAcwEXh0UDwdfGwcCChMbAUKHFgQP/oYDQSDSBQ8XuiAWBgwLAXQBEAiwJQ0NGAkREQEpUw0GEBUbUgVyR6MHEgQGNhYJCwcIBihlJwoIDBaAHwgWMQETDhwqZiQrLQUYtR54CggLBpsrCxwMGAoWLAcFDAFLORUyAU0UDxg0CQUUqqBwFgsGKgkEAQMKDRoXOXESBAsKDHwgAAsAAP9qA0oDUgAJAA8AFwAqADsAVwBfAHgAhACUAKYCzUAkpaGEfnsFFhWYARsWMQEBCQYBAgFWPjwgHAUGABI2KgIHAAZHS7AJUFhAcRwBGh4abx8BGxYdFhsdbQYBBAUJBQQJbRMNCwMJAQUJYw8IAgcADAwHZSQjIQMeABUWHhVgIgEWIAEdGRYdYAAZDgEFBBkFXgMBAQACEgECXgASEQoCAAcSAGAUEAIMABcYDBdhFBACDAwYWQAYDBhNG0uwClBYQH0cARoeGm8kIwIhHhUeIRVtHwEbFh0WGx1tBgEEBQ0FBA1tEwENCQUNYwsBCQEFCWMPCAIHAAwMB2UAHgAVFh4VYCIBFiABHRkWHWAAGQ4BBQQZBV4DAQEAAhIBAl4AEhEKAgAHEgBgFBACDAAXGAwXYRQQAgwMGFkAGAwYTRtLsAtQWEBnHAEaHhpvBgEEBQkFBAltEw0LAwkBBQljJCMhAx4AFRYeFWAiARYgHx0DGxkWG2AAGQ4BBQQZBV4DAQEAAhIBAl4AEhEKAgAHEgBgFBAPDAgFBwAXGAcXYBQQDwwIBQcHGFgAGAcYTBtLsA5QWEBxHAEaHhpvHwEbFh0WGx1tBgEEBQkFBAltEw0LAwkBBQljDwgCBwAMDAdlJCMhAx4AFRYeFWAiARYgAR0ZFh1gABkOAQUEGQVeAwEBAAISAQJeABIRCgIABxIAYBQQAgwAFxgMF2EUEAIMDBhZABgMGE0bQHIcARoeGm8fARsWHRYbHW0GAQQFCQUECW0TDQsDCQEFCQFrDwgCBwAMDAdlJCMhAx4AFRYeFWAiARYgAR0ZFh1gABkOAQUEGQVeAwEBAAISAQJeABIRCgIABxIAYBQQAgwAFxgMF2EUEAIMDBhZABgMGE1ZWVlZQEaVlZWmlaakoqCfm5mXlpKRiomDgn18enlzcmdmZWRfXltaU1JLSkZFQ0E5NzU0MzIwLykoJCMfHRsaERERERESEiMiJQUdKyUVFCMiJzU2MzIXFSM1NDIlMzUjFTMROwIRIxUGIyInJj0BIxUUFxYyPwE1NCcmIgc1IxEzNRYzMjc2NzUjFAcGIyI9ATM1NCcmIgcGHQEUFxYyNzY3NgE1NCIdARQyARQHDgEHBiAnLgEnJhA3PgE3NiAXHgEXFgEzBxUjNSYnJiczHwEVFAcGIicmPQE0NzYyFxY3ESM1BiMiJyY9ATMVFjMyNzUCHhYNDAwNFrwyMv3lPK47N6EyMhEPCgEBMgUHNB7wBQo6GDIyGRseCgW8MwEEEhpkDxZLFg8QFk4UCgIB/q0wMAGRDggyIGb+YmcgMgcPDwcyIGcBnmYhMAkO/dM5QzgIGhUQPCf1EBVMFQ8PFUwVELszHhwZCAQzAgoPEZx2JQyoDCYZGSZUNDT+wgEU0xcLAhLL2hwNFSI1bikOHx55/o4bHx8PLwcdBRQmMTksFRwcFSxgLBUdHg8PBQIZdScndSf+hINAIS4CDAwDLCI+AQhAIS4DCwsELCI+AkPfl5cqTTkvkydhLhQdHRUtYS0UHR0ULv7pHyMVDR3c4QwY1QAAAAEAAP+xAxwDUgAhACVAIhIFAAMAAQFHGgkCAUUEAQIARAIBAQABbwAAAGYcJxIDBRcrARMmIgcTLgInFjMyNxYfARYXNz4BPwEWMjcHBg8BBgcGAd8IIy8kCBeOZDMgHBgmIyhdNRg9KDQgPB49ICESCh8VB1EBPP51BwcBiyb+pE4ICD5CmlgnY0FSOWoICDEbETYlCooAAf/9/7EDXwMLAAwAEUAOAAEAAW8AAABmFRMCBRYrARQOASIuAj4BMh4BA1lyxujIbgZ6vPS6fgFedcR0dMTqxHR0xAACAAD/sANZAwsALwBiAFlAVltaAgQBAUcACQACAAkCYAALAAABCwBgAAoAAQQKAWAAAwUGA1QABQcGBVQABAAHBgQHYAAFBQZYCAEGBQZMVVRSUE9NPTw6ODc1KykoJyUkIRIsDAUXKwE0Ji8BLgEnNDY1NCcjIg8BIiYHIgYPAQYHDgIHFBYVFAYUFjI2FzIWMzI3PgI3FA4BBwYjIiYnIgYnIiY1NDY1NCY1ND4CNzY3NjMyFjcyNhcyFgcUDwEVFBYUFhUeAQMRCAYJAwQBBgYHChYhIoAiGDoSMkwlNUgaAQ4MDhk2DiB+H2U6SHZER06OVkVxH34gDTYOKTgMDhQqRjAsVmxEIoAhCiwKLSoBAgMECAkKAYUZTBAZCBgPDTINFQoCAxwBDAcTHhwpgoRJFloWDTIWEg4BEhUZeJpNXLaKIBkQARIBPikOMA0XWhc9eHJmJCEiLBwBBgE4Lw0ZJgoFCgQOAxZYAAAAAAYAAAAAA+gCOgALABUAHwApADQARgBbQFgvAQIGNC0qKSQjIB8aFhUQCwUCDwEAAkcACAYIbwAGAgZvBAECCQJvAAAJAQkAAW0ACQABCVQACQkBWAoHBQMEAQkBTDY1QkA9OzVGNkUkFBQUFB4YCwUbKzcUIyIvATc2MzIVHwEUIjUnNzQyFR8BFCI1Jzc0MhUfARQiNSc3NDIVHwEUIi8BEzYzMhUTFyI1ETQ3NjMyFhc2MzIWFAYjIgoGBA4OBAYKEFYYDAwYDlgcCgocDFogCAggClwiAgYGBA4SCEAODCQwWIIIGBo0TEw0sgQERkgEBEhsCAhspggIpmoKCGzeCgreagoKauAKCuBoDAxoAQAODv8AdA4BjAoEDnRUCkpmSgAGAAD/kgOYAyoAEQAbACEALQA2AD8AbUBqIh8XFAQCAwFHAAcOAQgEBwhgCgEAAAQJAARgAAkNAQYFCQZgAAUMAQMCBQNgCwECAQECVAsBAgIBWAABAgFMODcvLhwcExIBADw7Nz84PzMyLjYvNiwrKSccIRwhEhsTGwoIABEBEQ8FFCsBMhYVFAYHDgEjIiY1NDY3PgEDMjcuAScGFRQWEx4BFy4BFz4BNTQmIyIGBx4BASImNDYyFhQGJyIGFBYyNjQmAiyY1MCMIpxefrJsVgzQbnY4aJYWZHZYEGxKAnTcWHKWaFqOEHyu/goqPj5WPDwsGCAgMCIiAyrUlo7SClZutHxgmiKMwPzOZBaWaDh2VHYBlExqEFB0xBKMXGqUdFgCrgESPFY8PFY8oCIuIiIuIgAAAAAEAAD/agLkA1IAGAAiACoAMwAnQCQxKikbGhMSERANDAsARTMJCAcGBQBEAQEAAGYAAAAYABgCBRQrJRYHDgEvAQcnEwYvARMXFhcTFwcXHgEHBgMnBxQHFxY+ASYFFj4BJi8BBxMWPgEmLwEPAQIiMDQqkk5AbDjOREJ4unpCGs46bEBMLCowPEB8Aj40YDga/hY0YDgaMkCA3DRgOBwyPgR88FpaRiQsJLggAWYKJkYBREYoPAFmIrokLJZEWAEqJtgCBCQeGmBiwB4aYGQcJt7+zh4aYGIeJATYAAAAAAQAAAAAA4QCigAGAAwAEwAZAD1AOgYIAgAHAQECAAFeBAECAwMCUgQBAgIDWAkFAgMCA0wNDQEAGRgXFQ0TDRIPDgwKCQgFBAAGAQYKBRQrATIWHQEhNQE1IRUhIiE1IRUUBiMBNDMhFSEDUhQe/gz+cAEs/vwoAZAB9BwW/K4oAQT+1AKKHhTI+v3ayPr6yBYcAiYy+gAAAwAA/5wDAAMgAD4ATQBTAFxAWVIBBwYQAQIBCwEDAgNHAAYHBm8ABwoHbwAKBQpvAAUIBW8ACAkIbwAJBAlvAAQBBG8AAQACAwECYAADAAADUgADAwBYAAADAExRT0pJFiUlNS0TIiUmCwUdKwEUHgEOAiMiJyY3PgEzFwcGIyIHBhc3NicuAS8BJicuAiIGIyImJy4BNBczMjUnJjU0MzIXHgEfAjIeAQM2LgEiDgEXFj4BMh8BFgEUKwE3BgLuCggKHEo2migaCAJGIiIEDBoUBAQsViYKAiASMR8QHCQSBAwYLL4UIjg6dE4BAShaHhIWAgTKCh4wYAYQKjgiCAQIDiYaERwL/iIckLAEAnwEipbAlmYaFG4oJgJGAhomBAQEhBAUAwgFBAgoInQeFCLmRgRINCgUUg4IJBAODAYg/rgGNDQuLgYGAggGCgQBOBasigAAAAABAAD/sQPoAwwAHAAhQB4RAQABAUcCAQEAAW8DAQAAZgEAFxUNCwAcARwEBRQrBSInAScuAzU0NjcyHgIXPgMXMhYUBwEGAfQOC/6kDwoqIhqOfSJIPi4TFCxARiN9joD+pQpPCgFQDwo0Okwne4oBGCoiFRQkKBoBjPWA/rEKAAIAAP+xA+gDDAAcADkANUAyMgEBABoBAwECRwABAAMAAQNtAAMDbgUBBAAABFQFAQQEAFgCAQAEAEwoKh8VFRUGBRorATQuAw4DBwYiJy4DDgQHFBcJATY3FAcBBiInAScuAzU0NjcyHgIXPgMXMhYDoRgmNjI8QDwkEAoiCg4oOEQ4NjIqFAJpAUQBRGlHgP6lCh4K/qQPCioiGo59Ikg+LhMULEBGI32OAgUuRCoYDAQYMCASDQ0PJioeAgYeJEorXWn+yAE4aV17gP6xCgoBUA8KNDpMJ3uKARgqIhUUJCgaAYwAAAADAAAAAAPoAnYAFAAdACwAQ0BAIgEEBQFHBgEAAAMFAANgAAUABAIFBGAHAQIBAQJUBwECAgFYAAECAUwWFQEAKiglJBoZFR0WHQsKABQBFAgFFCsBMh4DFA4DIi4DND4DEzI2NCYiBhQWNxY+ARcUBiImNDYzMg4BAfRcqnBWKChWcKq4qnBWKChWcKpcXIKCuIKCXAg6KgRCXEBALg4IEAJ2MkpQPhw8UkoyMkpSPBw+UEoy/hJ+sn5+sn7WCAwKDiw+Plo+LjAAAAACAAD/agPoAsMAFwA9AD5AOzQIAgEAJgsCAwICRwADAgNwAAQFAQABBABgAAECAgFUAAEBAlgAAgECTAEAOzokIh0bEhAAFwEXBgUUKwEiDgEHFBYfAQcGBzY/ARcWMzI+Ai4BARQOASMiJwYHBgcjIiYnNSY2Jj8BNj8BPgI/AS4BJzQ+ASAeAQH0csZ0AVBJMA8NGlVFGB8nInLGdAJ4wgGAhuaIJypukxskAwgOAgIEAgMMBA0UBxQQBw9YZAGG5gEQ5oYCfE6ETD5yKRw2Mi4kPBUDBU6EmIRO/uJhpGAEYSYIBAwJAQIIBAMPBQ4WCBwcEyoyklRhpGBgpAAAAf/zAAADbwJUAA0ABrMIAwEtKxMJATYXFgcBBicBJjc2PwFyAXQWGhoa/nQWGv50GhoYAjr+nAFkGhoWGv54FhYBiBoWGAAAAf/0/6IB3gMcAA0ABrMJAwEtKwUWBwYnASY3ATYXFgcBAcQaGhoW/ngYGAGIFhoaGv6aFBoWGhoBihgaAYoaGhYa/owAAAAAAf/z/6IB3QMcAA0ABrMLBQEtKxcJASY3NhcBFgcBBicmDQFm/poaGhoWAYgYGP54FhoaFAFyAXQaFhoa/nYaGP52GhoWAAAAAf/0AAADbAJUAAwABrMHAwEtKyUJAQYmNwE2FwEWBwYDJP6M/o4aMBgBjBoWAYwYGBqCAWb+mhYuGgGGGhr+ehoYFgACAAD/2AMMAvAACwAZABdAFAQBAEUZFQ0HBABEAAAAZhIRAQUUKwEeAR0BBwEHNwE3NgE3JicuASMnDwEWFxYXAs4gHvz+3u4yASL8Nv5aGAIyFi4MDhYSHBIYDAKoIEAQEPz+4DTwASD8DP04GCwyFhoCGFAQEhgYAAAAAwAA/84D6ALuAAgAHQAyAGJAXwAFBgAGBQBtAAADBgADawABCAoIAQptAAoLCAoLawAEAAYFBAZgAAMAAgcDAmAMAQcACAEHCF4ACwkJC1QACwsJWAAJCwlMHx4vLSsqJSMhIB4yHzIiFSIRIxMSDQUbKwE0NjIWFAYiJicGKwE1Mz4BMzIXFhQHBiInJiMiBgUzFSMOASMiJyY0NzYyFxYzMjY3NgFUXoReXoRecg40oHYo0oSkeBAQEjISTnhkmAJQoHYo0IakdhISEDISUnRkmBYMAV5EXFyGXl5+PHh8nHQSMhIQEFJ8nHh8nHYSMhASElJ+XjwAAAAABP/6/5oD8wMaACsANwBWAF4AHUAaWVhAPwQARAIBAQABbwAAAGYdHBsaERADBRQrEw4BFCMHBgcGLwEmNz4BNzYyPgE3Mj4BNzY3MhcyBwYHBhcWFxYPAQYnLgEXARYPAQYnASY/ATYlFgcGJyYPASc3PgEmNzY3NhYHBgcGFhcWNz4BNzYWATcXBwYvASabCAYCEQ8EEAxGCw0CIAQGKh4IBgIOJhaGNHoaDBR4IFAsIgQICkwOBCo6+AGaEhQwFhD+YggISAwCMhAgMmg4LFJERBgOAgYMgAwMBAwiDgQmOiYGKAIEEvyo/kz2FBIuFgH6CBwWDw0EDhJMDAwCGAQGHDAGDh4QWgYCCDQYODouAggGRggEMBgy/iQWECoOEgHYCAw+CMBoPlgaDCxOTkYYOkgWODgGEgYMRAoyHCg+DDoECgL9RPhW8hQQLhIAAwAA/5wDhAMgAAgAEQAqAD9APB0BBAFGAAgGBAYIBG0ABwAGCAcGXgAEAAUABAVgAgEAAQEAVAIBAAABWAMBAQABTBIyEzIkExQTEgkFHSszNDYyFhQGIiYlNDYyFhQGIiYBBhYzIRUUIyEiPQEDIzU0OwEyHQEhERQHljxSOjpSPAH0PFI6OlI8/r4kBCoCMhT9chRsYhScFALAEig8PFI6OiooPDxSOjoBFgoaTBQUTAH0UBQUVv7uFgQAAAAAAQAA/7ED6AMuACsALUAqJgEEAwoBAAICRwADBANvAAQBBG8AAQIBbwACAAJvAAAAZiMXEz0XBQUZKyUUDwIGBwYiJic0Njc2NTQuBSsBFRQGIicBJjQ3ATYyFgcVMyAXFgPoRwYHAwUGEggBAgEDFCI4PlZWN30UIAn+4wsLAR0LHBgCfQGOWh7hXZ8NEQgECgwIBRQDJh84WkAwHhIGjw4WCwEeCh4KAR4KFA+P4UsAAAAAAgAA/7ED6AM1ABQAOgArQCgmAAIAAyEBAQACRxABA0UAAwADbwIBAAEAbwABAWY4NywqHRwkBAUVKyUVFAcGIyInASY0NwE2Fh0BBwYUFwUUDgIPAQYjIicmNzYnLgEnFRQHBiMiJwEmNDcBNhcWHQEWFxYBZRYHBw8K/uMLCwEdESzdCwsDYBIaHAgMBAsDAg4BGFMkdlsVCAYPCv7iCwsBHhAXFeZpXvYnFwoDCwEeCh4KAR4RExcn3gscC/MgVEZGEBYKAQQP31woLAeMFwoDCwEeCh4KAR4RCgkXkw9sYAAAAQAA/7ED6AMvACwAKUAmBwEAAQFHAAQDBG8AAwEDbwABAAFvAAACAG8AAgJmEyodMxQFBRkrARQHAQYiJjc1IyIOBRUUFxQWBxQGIicuAicmNTQ3NiEzNTQ2FhcBFgPoC/7jCxwYAn03VlY+OCIUAwQBChEGBAgGA0ceWgGOfRQgCQEdCwHtDwr+4gsWDo8GEh4wQFo4HyYEEgYIDAoFDhQDn11vS+GPDhYCCf7iCwAFAAD/bwPeA00AFQAZABwAKgAuAE1ASi4tAgECLBgCBQEeGhkXBAUDBQNHAAIBAm8AAQAFAwEFXgADAAQGAwRgBwEGAAAGUgcBBgYAWAAABgBMHR0dKh0qFSUXEiU3CAUaKwEWFA8BERQGByEiJicRNDYXITc2MhcJAScBBx8BBREHDgEHIzU0Nj8BIREBNycHA8YYGLkeFv1cFh4BIBUB1LkYPhj+iwFHcP64FQRYARWnFFYlnxYUpf7IAsBDckMCnxdAF7n+KxUeASAUAqUVIAG5GBj9hAFIcP65LFYEzQE4oBQaAZ8pUhSn/cICTkNyQwAAAgAA/yEDdQObABQARQBDQEAzLCghBAIFPDUfGAQBAj8VDQYEAAEDRyoBBUUABQIFbwMBAgECbwQBAQABbwAAAA0ASUNCOjgxLyUjHBoZBgUVKwEWEhUUAgcVFAYiJjc1JgI1NBI/ARM+ATcHBiMiJj8BJicHBiMiJj8BJicGBxcWBgciLwEGBxcWBiMiLwEeARcRND4BFhcBxbz02qwgKCIBrNr2vAk0fZ4DowgLEBANxAsicQgLEBANe2GjpGB6DRAQCwdyIgvEDRAQCwejBJx9ICoeAQOaI/7av7T+5C5AFR4eFUAuARy0vwEmIwH8ZivWhaQIHg7ETUFyCCILe4giIoh7DCABCHJBTcQOHgikhtQsAmAWHgIiFAADAAD/uQQWAroAFAAkADkAHkAbLhECAAEBRwMBAQABbwIBAABmNTQoJxcSBAUWKyUHBiInASY0NwE2Mh8BFhQPARcWFAEDDgEvAS4BNxM+AR8BHgEJAQYiLwEmND8BJyY0PwE2MhcBFhQBWBwFDgb+/AYGAQQFEAQcBgbb2wYBRNACDgYiCAYB0AMMByMHCAFs/vwGDgYcBQXb2wUFHAYOBgEEBUUcBQUBBAYOBgEEBgYcBRAE3NsGDgJO/S8HCAMJAwwIAtAIBgEKAg7+jv78BQUcBg4G29wFDgYcBgb+/AUQAAABAAD/tAMPAwgANgA9QDoAAgUGBQIGbQAGBAUGBGsAAQADBwEDYAAHAAUCBwVgAAQAAARUAAQEAFgAAAQATCYXJiUTFRUiCAUcKyUUBiMiJwEmNDYyFwEWFAYiJwEmIgYWFwEWMzI2NzQnASYjIgYUHwEWFAYiLwEmNTQ2MzIXARYDD1hBSzj+Tj98sEABUgUiEAb+rix0UgEqAbEjLiQuAST+vA4TEBYO5QYkDwXlI0AtMSIBRTdNQVg3AbJAr3w//q4FECIFAVMrVHUr/k8kMCMuIwFEDhYiD+QGECIF5SIxLkAk/rw2AAAAAAIAAP/5AoMDCwAHAB8AKkAnBQMCAAECAQACbQACAm4ABAEBBFQABAQBWAABBAFMIxMlNhMQBgUaKxMhNTQmDgEXBREUBgchIiYnETQ2FzM1NDYyFgcVMzIWswEdVHZUAQHQIBb96RceASAWEZTMlgISFx4BpWw7VAJQPaH+vhYeASAVAUIWIAFsZpSUZmweAAEAAP/5A6EDDAAlADBALQQBAgEAAQIAbQAAAwEAA2sAAwNuAAUBAQVUAAUFAVgAAQUBTBMlNSMVJAYFGisBFRQGByMiJj0BNCYOAQcVMzIWFxEUBgchIiYnETQ2FyE1ND4BFgOhFg4kDhZSeFIBNRceASAW/ekXHgEgFgF3ktCQAhGPDxQBFg6PO1QCUD1sHhf+vhYeASAVAUIWIAFsZ5IClgAAAgAA/2oCgwMLAAsALgA8QDkHAQIBAAFHAAMCA3AABwgGAgABBwBgCQUCAQICAVQJBQIBAQJYBAECAQJMLSwTMxEUIjMVFRMKBR0rATU0JiIGHQEUFjI2BRQGJyMDDgEHIyInAyMiJic0NjMRIi4BNjchMhYUBicRMhYBDAoQCgoQCgF3Fg7vHQEKBgEPAivhDxQBWDcdKgIuGwFlHSoqHTdYAXD6CAoKCPoICgq9DhYB/vIHCAEPAQ8UD0VuAR4qOioBLDgsAf7ibgAAAgAA//gDkwLFABAAMQAqQCcuJiUYFQ8ODQgBAwFHBAEDAQNvAAEAAW8CAQAAZiooIyIhERQFBRcrAREUBicjNSMVIyImJxEJARY3BwYHIyInCQEGJi8BJjY3ATYyHwE1NDY7ATIWHQEXHgEDEhYO1o/WDxQBAUEBQQF8IgUHAgcF/n7+fgcNBSMEAgUBkRIwE4gKCGsICnoFAgEo/vUPFgHW1hQQAQ8BCP74ASQpBQEDAUL+vgQCBSkGDgUBTg8Pcm0ICgoI42YEEAAAAwAA/7oDmANJABwAOQBaAKZAGjgBCQVVRQIABBMLAgEHA0dUKwIJRAYCBwJGS7AKUFhANgAFAwkEBWUAAQcCAAFlAAgAAwUIA2AACQAABwkAYAAEAAcBBAdhAAIGBgJUAAICBlgABgIGTBtAOAAFAwkDBQltAAEHAgcBAm0ACAADBQgDYAAJAAAHCQBgAAQABwEEB2EAAgYGAlQAAgIGWAAGAgZMWUAOV1YXFxooFxgaGBQKBR0rJTQvASYiBxceAR8BFAYHIi4BLwEGFB8BFjI/ATYBNC8BJiIPAQYUHwEWMjcnLgI1NDYXMh4BHwE2ARQPAQYiLwEmNDcnBiIvASY0PwE2Mh8BFhQHFzYyHwEWAywPdBAuEBYDDAECIBYIDg4EFhMQcw8tEFIP/ngPcxAsEFIQEHQPLhEXAwoEHhcJDg4DFxIB9DBSLocucy4xMTCHL3QvL1Ivhi9yLzExMIcvdC+rFw90EBIWAxAGDxceAQQKBBYRLg90Dw9REAGfFhBzEA9SDywQdA8RFwMODgkWIAEECgMXEf6OQy5RLzBzL4cwMTEvdC+GLlIuL3QuiDAxMS90LwAIAAD/sQOhA1IACwAXACQAPQBVAGIAbgB6AJJAj2oBDwlkAQwISTkCBQouAQEEEwwCBwMSDQIGAAZHAA8JCAkPCG0ADgwLDA4LbQABBAMEAQNtAAAHBgcABm0ACQAIDAkIYAANAAwODQxgAAsACgULCmAABQAEAQUEYAADBwIDVAAHAAYCBwZgAAMDAlgAAgMCTHh3cnFtbGdmYF9aWFJRHxcXJCQVFhUSEAUdKzcHBiImND8BNjIWFBcVFAYiJic1NDYyFicUBisBIiY0NjsBMhYFFA8BBiIvASYnNxcWMj8BNjQvATcWHwEWAQcnJiIPAQYUHwEHJi8BJjQ/ATYyHwEWBRQGKwEiJjQ2NzMyFgEVFAYiJj0BNDYyFhcHBiImND8BNjIWFPWPBQ4MBY8GDgtZChAIAQoODH4KCLIICgoIsggKAsIwUi6HLroMDIaYDy4PUg8PmQoUC7wv/qeFmBAsEFIQEJkKFAy7Ly9SL4YvugwBbQoIswgKCgizCAr+0AoQCgoQCuOPBg4KBY4GDguNjwUKEAWOBQoOHbMICgoIswgKCnUICgoQCgpQQy5RLzC7CxQKmQ8PURAsD5qFDAu8MAFSCpkQD1IPLBCZhgwMuzCFLlIuL7sMQggKChAIAQoBKLIICgoIsggKClyPBQsOBo8FCw4AAAAAAgAA/2oDkANSAAYACgAzQDAGAQQAAUcAAQABbwIBAAQAbwUBBAMDBFIFAQQEA1YAAwQDSgcHBwoHChMRERAGBRgrASMRIREjAQUVITUDkOz+oOwBnP5kAzgB8QFh/p/+ZHV2dgAAAAAD////sQPoAsMAGQA5AEkAOUA2GxIBAwMCEwACAQACRwAFAAIDBQJeAAMAAAEDAGAAAQQEAVQAAQEEWAAEAQRMNT0tGSo4BgUaKyURBgcGBw4CKwEiJi8BJicmJxEUFjMhMjYTNS8BJgYnISIGBxQXFhceBDczMj4DNzY3PgE3ERQGByEiJjcRNDYzITIWA6ESFZVZHCQ8GwIaPhEuWJYVEgwGAzYHCgECAwMEBvzKBwoBUmx0BCASIBgMAgsaHhQeBXRsHjRHNCX8yiQ2ATQlAzYlNAsBrBQRckoYHBoaDiZKchEU/lQICgoCUg4OBQUCAwwGXkFUXQIcDhQMAQoWDB4BXVQYUjX9oSU0ATYkAl8lNDQAAAAAAQAA/8oDoQNAACAAHUAaExALBgMFAAIBRwACAAJvAQEAAGYdFBgDBRcrARQPARMWFRQOAS8BBwYiJjU0NxMnJjU0NyU3NjIfAQUWA6EPyzABDBUM+/oNFQwBMMsOHwEYfgsgDH0BGCAB6QwPxf7pBAgLEAEHhIQHEgoECAEXxQ8MFQUo/hcX/igFAAACAAD/ygOhA0AACQAqACdAJB0aFRANCQgHBgUDAQwAAgFHAAIAAm8BAQAAZiYlGBcTEQMFFCsBNy8BDwEXBzcXExQPARMWFRQjIi8BBwYiJjU0NxMnJjU0NyU3NjIfAQUWAnqr62pp7Ksp09P+D8swARcKDPv6DRUMATDLDh8BGH4LIAx9ARggASKlI9XVI6Xrb28BsgwPxf7pBAgcB4SEBxIKBAgBF8UPDBUFKP4XF/4oBQACAAD/sQMTAwwAHwAoACVAIgAFAQVvAwEBBAFvAAQCBG8AAgACbwAAAGYTGSMUGTIGBRorJRQGIyEiJjU0PgUXMh4CMj4CMzIeBQMUBiImPgEeAQMSUkP+GENSBAwSHiY6IQUmLExKSjAiByI4KBwUCga0frCABHi4dkJDTk5DHjhCNjgiGgIYHhgYHhgWJjQ6PjwB1lh+frCAAnwAAAAAAwAA/7EEeAMMAAgALABPAHdAdCwlAgoHIB8OAwMCMhMCBAgDRwABBwFvAAcKB28OAQAKDQoADW0ACw0CDQsCbQwBCgANCwoNYAYBAgUBAwgCA2AACAQECFQACAgEWAkBBAgETAEATUtKSEVEQT82MzEvKSgkIhwbFxUSEAoJBQQACAEIDwUUKwEiJj4BHgIGBTMyFgcVFAYrARUUBgcjIiY9ASMiJic1NDY3MzU0NhczMhYXARQWNzMVBiMhIiY1ND4FFzIXHgEyNjc2MzIXIyIGFQGJWX4CerZ4BoQBw8QHDAEKCMQMBmsICsUHCgEMBsUKCGsHCgH+ZSodjyY5/hhDUgQMEh4mOiELCyxUZFQsCwtJMH0dKgFefrCAAny0ekkMBmsICsUHCgEMBsUKCGsHCgHEBwwBCgj+vx0sAYUcTkMeOEI2OCIaAgoiIiIiCjYqHQAAAAADAAD/sQRyAwwACAAsAE4AVEBRSQEAByQbEgMCCDIBBgIDRwABBAFvBQEEBwRvCQEHAAdvCgEACABvAAgCCG8DAQIGAm8ABgZmAQBIRkRDQT82MycmIiEVFBAPBQQACAEICwUUKwEiJj4BHgIGBRcWFA8BBiIvAQcGIi8BJjQ/AScmND8BNjIfATc2Mh8BFhQHBQcGFB8BBiMhIiY1ND4FFzIXFjI3NjMyFw4BBxQXAYlZfgJ6tngGhAIEiwUFTAUPBYuLBQ8FTAUFi4sFBUwFDwWLiwUPBUwFBf5fZRUVLgsN/hhDUgQMEh4mOiELC1a4VgsLDxAPDgEVAV5+sIACfLR6tYoGDwVMBQWLiwUFTAUPBoqLBQ8GSwUFi4sFBUsGDwWLZRQ8FS4CTkMeOEI2OCIaAgpERAoEDxoSHhUAAAb///9qBC8DUgARADIAOwBEAFYAXwBvQGxPDgIDAgFHEQEJCwlvAAsIC28QAQgCCG8PAQIDAm8HAQUAAQAFAW0MCgIBBgABBmsABgQABgRrAAQEbg4BAwAAA1QOAQMDAFgNAQADAExeXVpZVlRSUEtKSUdDQj8+OjkZFRQZNyMTIRASBR0rAQYHIyImNzQzMh4BNzI3BhUUARQGIyEiJic0PgUzMh4CPgE/ATY3Mh4EFwEUBiImNDYyFgEUBi4BPgIWBRQGJyMmJzY1NCcWMzI+ARcyJxQGIiY0NjIWAUtaOkstQAFFBCpCISYlAwKDUkP+GERQAQQMECAmOiEGJC5IUEYZKRAHIzgmIBAOAf3GVHZUVHZUAYl+sIACfLR6AUM+Lks5Wi0DJSUhRCgERUdUdlRUdlQBXgNELCzFFhoBDRUQTv5bQk5OQh44Qjg0JhYYHBoCFhAaCgIWJjQ4QhwCjztUVHZUVP7vWX4CerZ4BoTTKy4BRANBThAVDRgYAY87VFR2VFQAAQAAAAADpAKYABUAHUAaDwEAAQFHAAIBAm8AAQABbwAAAGYUFxQDBRcrARQHAQYiJwEmND8BNjIfAQE2Mh8BFgOkD/4gECwQ/uoPD0wQLBCkAW4QLBBMDwIWFhD+IA8PARYQLBBMEBClAW8QEEwQAAEAAP/vAtQChgAkAB5AGyIZEAcEAAIBRwMBAgACbwEBAABmFBwUFAQFGCslFA8BBiIvAQcGIi8BJjQ/AScmND8BNjIfATc2Mh8BFhQPARcWAtQPTBAsEKSkECwQTBAQpKQQEEwQLBCkpBAsEEwPD6SkD3AWEEwPD6WlDw9MECwQpKQQLBBMEBCkpBAQTA8uD6SkDwABAAD/+QMSAwsAIwApQCYABAMEbwABAAFwBQEDAAADVAUBAwMAWAIBAAMATCMzJSMzIwYFGisBFRQGJyMVFAYHIyImNzUjIiYnNTQ2NzM1NDY7ATIWFxUzMhYDEiAW6CAWaxYgAegXHgEgFugeF2sXHgHoFiABt2sWIAHpFh4BIBXpHhdrFx4B6BYgIBboIAABAAAAAAMSAe0ADwAYQBUAAQAAAVQAAQEAWAAAAQBMNTMCBRYrARUUBichIiYnNTQ2NyEyFgMSIBb9WhceASAWAqYWIAG3axYgAR4XaxceASAAAAAC//3/sQNfAwsAFQAiADBALQcBAgEBRwAEAARvAAABAG8AAQIBbwACAwMCVAACAgNYAAMCA0wVFxcUFAUFGSsBNC8BJiIPAScmIg8BBhQfARYyNwE2FxQOASIuAj4BMh4BAs0LMgscDON+CxwMMgoKygoeCgEvC4xyxujIbgZ6vPS6fgG4EAoyCwvjfgsLMgofCsoKCgEvCkt1xHR0xOrEdHTEAAL//f+xA18DCwAkADEAMEAtHhUMAwQCAAFHAAUBAQACBQBgAwECBAQCVAMBAgIEWAAEAgRMFRcUHBQZBgUaKyU0LwE3NjQvASYiDwEnJiIPAQYUHwEHBhQfARYyPwEXFjI/ATY3FA4BIi4CPgEyHgECgQplZQoKMwoeCmVlCx4KMgsLZWULCzIKHgtlZQoeCjMK2HLG6MhuBnq89Lp+4A4LZWULHQsyCwtlZQsLMgsdC2VlCx0LMgsLZWULCzILjXXEdHTE6sR0dMQAAAL//f+xA18DCwAjADAAQUA+DQEAAR8BBAMCRwIBAAEDAQADbQUBAwQBAwRrAAcAAQAHAWAABAYGBFQABAQGWAAGBAZMFRUjJCUjJBQIBRwrATU0JgcjNTQmJyMiBgcVIyIGFxUUFjczFRQWFzMyNjc1MzI2NxQOASIuAj4BMh4BAqcWDo8WDkcPFAGPDhYBFA+PFg5HDxQBjw4WsnLG6MhuBnq89Lp+ATpIDhYBjw8UARYOjxQPSA4WAY8PFAEWDo8UM3XEdHTE6sR0dMQAAAAC//3/sQNfAwsADwAcAB1AGgADAANvAAABAG8AAQIBbwACAmYVFTUkBAUYKwE1NCYHISIGFxUUFjchMjY3FA4BIi4CPgEyHgECpxYO/lMOFgEUDwGtDhaycsboyG4Gerz0un4BOkgOFgEUD0gOFgEUM3XEdHTE6sR0dMQAAgAA//gCOQLDAA8AOgBkS7APUFhAJgAEAwIDBGUAAgEDAgFrAAUAAwQFA2AAAQAAAVIAAQEAWAAAAQBMG0AnAAQDAgMEAm0AAgEDAgFrAAUAAwQFA2AAAQAAAVIAAQEAWAAAAQBMWUAJJxQbHxYkBgUaKyUVFAYnIyImPQE0NhczMhYTFA4DBw4BFRQGByMiJj0BNDY3PgE0JiIHBgcGIyIvAS4BNzYzMh4CAYkOCIYJDg4JhggOsBAYJhoVFx4OCYYIDEoqIRw0RhgUKAcKBwdbCAIEWaotWkgulYYJDgEMCoYJDgEMAUUeNCIgEgoNMA0KEAEUCxouUhMPIjAkEA4yCQRGBhAIlCI6VgAAAAAD//3/sQNfAwsADwA3AEQASEBFKQEFAwkBAgEAAkcABAIDAgQDbQADBQIDBWsABwACBAcCYAAFAAABBQBgAAEGBgFUAAEBBlgABgEGTBUeKxMWJiYjCAUcKyU1NCYrASIGHQEUFjsBMjYTNC4BIyIHBh8BFjMyNz4BMhYVFAYHDgEXFRQWOwEyNjQ2PwE+AxcUDgEiLgI+ATIeAQH0CghrCAoKCGsICo8+XDGIRwkNSgQGCQUeJTgqFhsjPAEKCGsIChgSHAoeFAzXcsboyG4Gerz0un5SawgKCghrCAoKAX8xVC53Dgo3BAcmGx4SFRoMEEAmFAgKChIiCxAGGhwoUnXEdHTE6sR0dMQAA//9/7EDXwMLAB4ALgA7AElARiggAgYFDgYCAgEYAQIEAANHAAgABQYIBWAABgABAgYBYAACAwEABAIAYAAEBwcEVAAEBAdYAAcEB0wVFiYmJhEmIyMJBR0rJTU0JisBETQmKwEiBh0BFBY7ARUjIgYdARQWOwEyNgM1NCYrASIGHQEUFjsBMjYFFA4BIi4CPgEyHgECOwoHNgoIsggKCgg1NQgKCgj6BwpHCghrCAoKCGsICgFlcsboyG4Gerz0un5SWQgKAR4ICgoIWQgKswoIWQgKCgH8WQgKCghZCAoK4HXEdHTE6sR0dMQAAAAAAgAA//kBZgMLAB4ALgA/QDwfAQUGGhICAgMIAAIAAQNHAAYABQMGBWAAAwACAQMCYAQBAQAAAVQEAQEBAFgAAAEATDUmIyYhFjMHBRsrJRUUBgchIiYnNTQ2NzM1IyImJzU0NjczMhYXETMyFgMVFAYHIyImPQE0NjsBMhYBZRQQ/uMPFAEWDiMjDxQBFg7WDxQBIw8WSBYOjw4WFg6PDxRkRw8UARYORw8UAdYWDkcPFAEWDv6/FgJ1aw8UARYOaw4WFgAAAAACAAD/+QEwAwsADwAfACxAKRkREAMCAwFHAAMCA28AAgECbwABAAABVAABAQBYAAABAEw1JiYkBAUYKyUVFAYHIyImPQE0NhczMhYTAw4BJyMiJicDJjY7ATIWAR4WDo8OFhYOjw8UEQ8BFg6PDhYBDwEUD7MOFpp9DxQBFg59DhYBFAI+/lMOFgEUDwGtDhYWAAAAA//9/7EDWQMLAAwAHAAuAERAQSgeAgUEFhUOAwMCAkcGAQAABAUABGAABQACAwUCYAADAQEDVAADAwFYAAEDAUwBACwqIyEaGBIQBwYADAEMBwUUKwEyHgEUDgEiLgI+ARM1NCYrASIGBxUUFhczMjYnEzQnJisBIgcGFRMUFjsBMjYBrXTGcnLG6MhuBnq8wQoHawgKAQwHawcKAQoGBQh7CAUGCgoJZwgKAwt0xOrEdHTE6sR0/UhqCAoKCGoICgEMxwFaBwMFBQMH/qYGCAgAAAAB//MAAAHfAfAADQAGswYBAS0rATYXFg8BBi8BJjc2HwEBlRYaGhrEFhrEGhoYGqoB1hoaFhrAFhbAGhYYGJwAAf/0AAABFgJUAA0ABrMJAwEtKzcWBwYvASY/ATYXFg8B/BoaGhbAGBjAFhoaGpy0GhYaGsIYGsIaGhYarAAAAAH/8wAAARUCVAANAAazCwUBLSs/AScmNzYfARYPAQYnJg2enhoaGhbAGBjAFhoatKqsGhYaGsIaGMIaGhYAAAAB//QAAAHcAfAACwAGswUBAS0rNwYmPwE2HwEWBi8BPhowGMQaFsQYMBqq5hYuGr4aGr4aLhaeAAMAAP/iAvgC2gAHAA8AGAA4QDUAAAACAwACYAADAAUGAwVgCAEGAQEGVAgBBgYBVgcEAgEGAUoREBUUEBgRGBISERISEAkFGisRIAARIxAAIRUyABUjNCYjFzIWFAYiJjQ2AToBvnb+iP722gEydu6oci5ERFxERALa/kL+xgEKAXZ2/s7Ypu6yQl5CQl5CAAIAAAAAAsUCoAACAAUACLUFAwIAAi0rCQInLQECxf4sAdRG/u0BEwKg/r7+voW9vQAAAAACAAAAAAMQAqAAAgAFAAi1BQMCAAItKyUJARcNAQE8AdT+LEYBE/7tHAFCAUKFvb0AAAAABQAA/5YDvAMUACcALgA1AEUATwBLQEgzAQAETEs1LSAXCgEIBQYCRwADAgNwAAEHAQQAAQRgAAAABgUABmAABQICBVQABQUCWAACBQJMKShAPzg3KC4pLhQdNRcIBRgrJSc3NjQvASYiDwEBLgErASIGHQEUFhcBBwYUHwEWMj8BFxYyPwE2NAEyFhcBBwETLgE9AQEPAQYiLwEmND8BNjIfARYUBxMHBiIvATcXFhQDroZGEhIGEjQSRf7gDSsZ/A0SGBYB6UUTEwUSNBJGhg4lEDEO/Z4RHQgBJBn92QkOEQInGBUJGgkFCQn/ChgKBgkJQDIEDQWGSIYFGIZGEjQSBRMTRQHpFhkTDfwZKw3+4UYSNBIGEhJGhg4OMQ4oAukRDv4QGAIn/s4IHRHm/dkZpAkJBgkaCf8KCgUJGgn+8jIEBIZIhgQNAAADAAD/agNaA1IAAgAXACwALEApAgEARAAAAQBwAAIAAwQCA2AABAEBBFQABAQBWAABBAFMGRoZFxAFBRkrJSEHARQHBgcGIicmJyY0NzY3NjIXFhcWBzQnJicmIgcGBwYUFxYXFjI3Njc2AVwBMZkBZjEwUVPCU1EvMTEvUVPCU1EwMUcnJkFDnENBJicnJkFDnENBJidG3AKDYVNRMDExMFFTwlNRLzExL1FTYU5DQSYnJyZBQ5xDQScnJydBQwAGAAD/gwPoAzkAIwAnACsALwAzADwAiECFIQEHAAUBAQ0XAQkCDwEDCARHEAEAEQEHBgAHXgAGAAwOBgxeEwEOAA8NDg9gEgENCwUCAQINAV4KBAICAAkIAgleAAgDAwhSAAgIA1gAAwgDTDU0MDAkJAEAOTg0PDU8MDMwMzIxLy4tLCsqKSgkJyQnJiUdHBsZExELCgkHACMBIxQFFCsBISIGFREUFjMhFSMiBh0BFBYzITI2PQE0JisBNSEyNjURNCYHESERASE1IScjNTMlNSEVJSIGFBYyNjQmA9b8PQgLCwgBgGwHCwsHAa0ICgoIcgF0CAoKG/xiApz+eQGHhIWF/egDnv44CQ0NEg0NAzkKCP1sCAp0CghmBwsLB2YICnQLBwKUCAok/ikB1/ySQSV0JHR0TAwSDQ0SDAAAAAX/9v/MA+kC8QA+AEoAVgBxAHwAdUByeWNGMA8FBwZAAQoHc2RFAwkKcAEMCXEBCwwFR3gBCgFGAAADAG8AAwAIBQMIYAACAAUGAgVgAAEABgcBBmAABwAKCQcKYAAJAAwLCQxgAAsEBAtUAAsLBFgABAsETG5sW1lTUk1MFSgjHy8lIxQRDQUdKwEmIgcGBwYHBicmBwYHBgcuASMiBg8BOAExBwYHBhYfAR4BMzI2PwE4ATE3Njc2Jic2NzY3NhcWNzY3Njc2NAUHJiMiDwEnPgEyFgMGIiY0PwE2MhYUBwMOASMiJi8BLgE2PwEXBw4BFRQXHgEzMj8BFzcnNzY1NCc3HgEGA+MGDwUeGRUVDRkdERwcISYlXTU7cCsCqzkWFSA0FCRfNjpwLKsDOBYVHjIfGxYWDhkdEBsaISQF/pJSExQfGCR5JlxcUIcKIxcMSAwhFwtJJmI0LlMeFC0bJzGeeQoLDBcKHQ8hFQt5GnkkFgtSKhshAusFBR4NCwEBBAUBAQ0QIyMlMCsCqzlKSZA0EyUmLyusAjhJSI80HQ4KAQEFBAEBDRAkBRCGUgsWJHkhJB/+6gwXIwpIDBcgDf6RJiohHxQtfYAxnnkLCh0PIRULDBcKeRp5JBgeFRNSK3d6AAAAAv///2oD9ANSACgATQAyQC89NiMRBAECAUcAAgMBAwIBbQABAW4AAAMDAFQAAAADWAADAANMSkg7OhYVIQQFFSsBJiMiBgcGDwEnJgcGBwYHBhcHBhQWMj8BPgE3Njc2Nz4BLwE3Njc+AQMHDgEfAQYHBgcGBwYHATY0JiIHATY3NjcXFjY/AT4BMzIXFgYDxCRAV+pzAwIrOgsHPCEaCQYCpwUMDQemW71QaksoEgQBAhR7BQFJHYOEBgUCFyARR2VMWU07AVgFCw8F/qMDFR8/PgcMAi9r3k4xGSQgAy4kfm0DBYEJAglLZUxUNymnBQ8LBacINCk1TCgVBAoFN0YCBHW7/udLAw0HOyIRRzMnGRUHAVgFDwsF/qNTUHZTCgEHBoxleRklpAAABgAA/7cD3QLPAGkAeQCFAJEAoQCtAGdAZC0aCQMIBqiFMQUEBQinoaB6eWpjVE0+CgcFA0cACAYFBggFbQkBBQcGBQdrBAECAwJwAQEACgEGCAAGYAAHAwMHVAAHBwNYAAMHA0ysqqalj46JiIOBfHtaV1FQSkg1NBELBRUrASYiBg8BNTQmJzc+AhYXFj4BJicuAQ4BDwEnBycuAgYHDgEeATc+AR4BHwEOAR0BJy4BIgcOAR8BHgEfAQcOAx8BHgEXMzI2PwEVFBYyNj0BFx4BOwE+AT8BNi4CLwE3PgE/ATYBBwYHBiYnJi8BJjY3Nj8BNSUuAS8BJjYzMhcFExQGIiY1ETQ2MhYVFxYXHgEPAQYHDgEnJi8BNQEHDgEHBTUlNjMyFgPKEz88GfAQDRAHHiwsEwUNCAIFGTw6KggQBAQQCCo6PBgFAwgNBRMsLB4HEQ4P8Rk8PhQJBQU5CSwcuXgTIRUEB04HJhkEFyYKPSQ0JTwKJhcEGSYHTgcEFiATeLkcLAk5Cf3aWQcOCxsLDAZOBAMHDhzP/uwTHQY5BRIRNC0BBF0SGhISGhLvGw4HAwROBgwLGwsOBlkBgjkGHRP+7QEDLTQQEwKcGhUUwC0QHQg6FyAOBg4EAgoNBBIKFCwdOgEBOh0sFAoSBA0KAgQOBg8gFjoIHRAtwBQVGgweDqwaIwIRGAQYIikT6hccAhgWhSUaJSUaJYUWGAIcF+oTKSMXBBgRAiMarB7+NMQPCAYCBwkP6g0bCxkFKiQZARgRqxAaItD+oA0SEg0BtQ0TEw3JBRkLGw3qDwkHAgYID8SlARKrERgBGSbQIhoAAAUAAP/IA2kCygAuADsAQQBPAFoAL0AsQz49FhULAQAIAUUDAgIBAAABVAMCAgEBAFgAAAEATFBQUFpQWjo5JCEEBRQrJTU+Aj0BNC4BDwEnJg4BHQEUHgEXFS4BJyYOARceARcWOwEyNz4BNzYuAQcOAQUuAScmNhceAhciJgEVJzc2FiUFMQ4CJy4CPQE0NhM+Ajc2FgcOAgH0NFYyHiwUbm0ULR0yVjQnnWQUJRMDEGRMUGEfYVBMZBADEyUUZJ3+wSItCgIXEFCEUQZJfgGEjF0QH/7XASgEOFYwKkQmH50HUYRQEBcCDl6PZNwEOFk1fhciCQw/PwwJIhd+NVk4BNxdghMEEiMVXpUqKysqlV4VIxIEE4JtJmE4ERcEEGCOUjgCaWxRNgkSCasuSyUGBTNNK3gSEv07Uo5gEAQXEViITAAAAAADAAD/sQQwA1IACAAiACsAUEBNAAUCBW8ECQICBwJvAAcAB28IAQABAG8AAQYBbwoBBgMDBlQKAQYGA1gAAwYDTCQjCgkBACgnIyskKx8cGRcSDwkiCiIFBAAIAQgLBRQrATIWFA4BJj4BJTIWBxEUBiMhIiY1ETQ2OwE3PgEzITIWHwEBMj4BJg4BHgECGEJeXoRgAlwBzTtUAVI8/O47VFQ7fRwLOB4BHh04Cx3+9GeSApbKmAaMAdtehlwCYIJi5lQ7/gw7VFQ7AfQ7VEwbKCgbTP19lMyWBI7UjAAAAAz//f9wA+oDTgAnACsAMABgAGoAdQCDAJIAnwCtALoAyQFIQAxjQz4DCQ4SAQECAkdLsAlQWEBMFwEUDQgNFAhtEwESBAUEEgVtFQEAAA0UAA1gCgEIEQEOCQgOYBAWDwMJCwcCBBIJBGAMBgIFAAMCBQNeAAIBAQJSAAICAVgAAQIBTBtLsApQWEBSFwEUDQgNFAhtABIEEwQSE20AEwUEEwVrFQEAAA0UAA1gCgEIEQEOCQgOYBAWDwMJCwcCBBIJBGAMBgIFAAMCBQNeAAIBAQJSAAICAVgAAQIBTBtATBcBFA0IDRQIbRMBEgQFBBIFbRUBAAANFAANYAoBCBEBDgkIDmAQFg8DCQsHAgQSCQRgDAYCBQADAgUDXgACAQECUgACAgFYAAECAUxZWUA5vLthYQYAu8m8ybe2pqVycG1rYWphaWZkWllQT01LSEZBQDs6NzU0My8uLSwrKikoFhQAJwYnGAUUKwEwOQEwMSIOAhUUFhcWFxYdARQWMyEyNj0BMDE0NzY3PgE1NC4CEyM1MwMzAyM0FwYHIxMzMjY0JiIHBgcGFSMmNSYnJiMiBhQWOwEWFSMmJy4BNTQ+AjIeAhUUBic0NTYzMhYUBisCIiY0NjMyFxYXExYyNj8BNi4BBg8BBhYlHgEzMjc+AS8BLgEOARcBFxYyPgEmLwEmDgEWEwcOARcWMzI/AT4BLgEFJyYOARYfAjI3NiYDMj8BPgEuAQ8BDgEXHgEB8ztrUi02MQsHCgsHASAICgoHCzI1LVJrQvr6oUgDQsclAzgDKBkkJDMTFwYBSwEFERQgGSUlGScDOAMlKy8nSF1oXUkmL4YHHwoODwm7JgoPDwoSCgcCzgIKCgJAAwYODgNAAwb+6gIKBQMEBwYDPAMODgYD/u+VAgoKBQYHlAcOBgWclQcHAwUNBAKWBwYFDwM0lQcOBgYHlAcMBQMFowQDlQgGBg4HlgcGAwEKAn4rUms6QnMpCBYgOIYHCwsHhzggFwgpcUI6a1Ir/RdhASf+/pYUH2MBAiYzJRATJQMOCAkfFBcmNCZjn2EfImY5M11HJiZHXTM5Y4IGBSkPFRAQFhAPCxABRQEGBZQHDwYGB5QIDgcFBwICDweVCAYGDgf+3UABBgwOA0ADBg4O/sw8Ag4ICwE8Aw4OBkE/AwYODgM/AgsHDwEyATwDDg4GAzwDDQgFBgAHAAD/xAOqAvYADAAZACYAMwCEAJEAngCnQKROSQIQE3ZxAgMAVEMCAgMDRw4aAggJCG8NAQkKCW8MAQoVARMQChNgAAsAEAALEGAYBBYDAAcBAwIAA2AZBhcDAgUBARICAWAbFAISDw8SVBsUAhISD1gRAQ8SD0yTkjU0KCcbGg4NAQCZmJKek56PjomIfnx0c2tqZGJcW1JQTEtHRTw5NIQ1hC4tJzMoMyEgGiYbJhQTDRkOGQcGAAwBDBwFFCsBIg4BFB4BMj4BNC4BByIuATQ+ATIeARQOASUiDgEUHgEyPgE0LgEHIi4BND4BMh4BFA4BEyYGBwYWMzEyNz4BHgEVES4BIyIGBycmIg8BLgEjIgYHETQ+ARYXFjMxMjYnLgEHDgEVERQeAj4BNTQmJzc2Mh8BDgEXHgIXFj4BNRE0JgEUDgEiLgE0PgEyHgEFIi4BND4BMh4BFA4BAQomQSYmQUxBJSZAJh4yHh4yPDIdHTIBtiZAJiZATEEmJkEmHjIdHTI8Mh4eMnMVIwcCCQgKBQMSFxAcWjYmRxsNKFooDBxHJjZaHBAXEgMFCggKAwcjFRkhNFtuYTgXFQUhSyAGFxcCAjRVMzpjOyL+Li9PXE8vLk9eTy4BKC5PLi5PXE8vLk8BICZBTEEmJkFMQSb6HTI8Mh0dMjwyHfomQUxBJiZBTEEm+h0yPDIdHTM7Mh0CzgEXFAgMCwkMAxIN/kssMxwZBxcXBxkcMywBtQ0SAwwJCw0HFBcBASYZ/eM3XjkCNl44I0EaBBISBBxGJjNWNQMDNWA5AiEZJv2gL08uLk9eTy4uT9suT15PLi5PXk8uAAAAAAb////BA+gC+wAYADYAPwBIAIMAwQEmQAtlAQMAs1YCCwMCR0uwCVBYQEkACwMJAwsJbQAJBAMJBGsACAAODAgOYA0BDAAKAAwKYAAAAAMLAANgDwEEAAcGBAdgAAYABQIGBWAAAgEBAlQAAgIBWAABAgFMG0uwClBYQE8ADA4NDQxlAAsDCQMLCW0ACQQDCQRrAAgADgwIDmAADQAKAA0KYQAAAAMLAANgDwEEAAcGBAdgAAYABQIGBWAAAgEBAlQAAgIBWAABAgFMG0BJAAsDCQMLCW0ACQQDCQRrAAgADgwIDmANAQwACgAMCmAAAAADCwADYA8BBAAHBgQHYAAGAAUCBgVgAAIBAQJUAAICAVgAAQIBTFlZQCE4N7u5o6KhnIuJa2lcWk9NRkVCQTw7Nz84Pz0uODEQBRgrASYrASIGBwYHBhUUFjMhMjY1NCcmJyYnJhMUBw4BJyEGJicmNTQ3Njc2Nz4BOwEyHgEXFhceASUiBhQWMjY0JhcGIiY0NjIWFAEmJy4BIyIHBgcGFwcVHgEXFjMyNz4BNzY3Nj0BNDc+ATMyFxYXHgEdARQXHgEXFhcWFxY3Njc2NzU0BxQHBgcGIycmJyYnJj0BNCYnJicmJyYvASYHIjEiBwYHDgIdARQOAQcGBwYnJic1NyY3PgEzMhcWFx4BFQJdMTcBUIUvJxQSKiUCBSUrFBYpHyImggQEDAT9+wUMBAQRDyYhLhtEJwEmRDUUEhAlIP7mRF9eiV9hCiBZQD9bPwFZLklLsGCSd3Q4MwEBAgwNGzYSBjU4CwcCAgYUhU1APzceDg4BAg8NDxgbIkUiDAgGATcCAwYNHBE9DwQBARsXFB8dHS8KLwcJECUTJCUtSykBBAYTNS4NCAQBASIy04rCgDYkFRgCBxVVUUBSTEFGUFBFSExSQTEgJf5jHRgVFwIBFhUYHj1DQEQ3JRYYGCsXFhw/idtfiV5fhmHwID9bPz9bAd0wGhwdICA5Mz8SJxAnDxwBBx0YEBANGQsGBhQcCgkOCA0GCBsMESIKCwkJBAgiDBcTETg5Sh8PEwcLAQYUBQ4IGQkWJA0LCQgFBQEEAQECAgUFHSodCxENEgYRBQQOChkjFCkiMjg0FRwQKhcAAAT///+xA6EDCwADAAwAFQA9AFlAVg0BAQIXAQYBAkcAAwQJBAMJbQgBBgEAAQYAbQAKAAQDCgReCwEJAAUCCQVgAAIAAQYCAV4AAAcHAFIAAAAHWAAHAAdMPDozMC0rEzMpExMhEREQDAUdKxchNSE1ITUjIiY9ASEBNC4BDgEWPgE3FRQGByMVFAYjISImJzUjIiY3NTQ2FzMRNDYzITIWHwEeAQcVMzIW1gH0/gwB9FkWIP6bAoMUIBICFhwYRgwGfSAW/egWHgF9BwwBQCskIBUBdxc2D1UPGAEjLT4Hj9bWIBZZ/ncPFAIYGhgEEBHoBwoBWRYgIBZZDAboLEABATAWIBgOVRA2Fo8+AAAAAgAA//kDoQNSACkAVwBFQEIACAEIbwAEBQYFBAZtAAYDBQYDawABAAIHAQJgAAcABQQHBWAAAwAAA1QAAwMAWAAAAwBMU1FNSyUlHDUpJTMJBRsrARUUBiMhIiY1ETQ2NzMyFgcUBwYHBisBIgYHERQWFyEyNj0BNDc2NzYWEwcGIyInJj0BIyIHBhcWDwEiLwEuAyc0Pgc3MzU0NzYzMh8BFhQDEl5D/jBDXl5DjgcMAQ8rHwUEPiU0ATYkAdAlNAoQDgkXhNYKDwcHFlm1QEIZAg0HCQUMBiAYEgEEDBIkKEBMZjtZFgcHDgvWCwEqkENeXkMB0EJeAQwGDwMPEwI0Jf4wJTQBNiR3CwUHDgkKAQrWCwMJGGtJTbsNBgEHEQk8Mk4dGzA0LiwoHBoIAmsYCQML1goeAAAAAAIAAAAAA+gCuQAjADcAKUAmGxIJAwUEAUcBAQAEAG8ABAUEbwAFAgVvAwECAmYlJxQcFBYGBRorATc2NC8BJiIPAScmIg8BBhQfAQcGFB8BFjI/ARcWMj8BNjQnAQcjIgYdARQWOwEXFjc2NRE0JyYDWIEPDyMPKQ+BgQ8pDyMPD4GBDw8jDyoOgYEPKQ8jDw/9o+BdIxwdIl3gFw8TEw8BXoEPKg4kDg6Cgg4OJA4qD4GBDyoOJA4OgoIODiQOKg8BzK8cIrwiHK8QBAQhAmQhBAQAAwAA/8cD6AL1AA8AHwAzACRAIRgRAgEAAUcBAQBFGQkIAwFEAAABAG8AAQFmKigjIQIFFCsBBxYXFhQHBgcXNjc2NCcmBQcWFxYUBwYHFzY3NjQnJiUHIyIGHQEUFjsBFxY3NjURNCcmAzB1RSYoKCZFdVYwMjIw/ud5KRocHBopeTkiIyMi/tbgXSMcHSJd4BcPExMPAvVkOU5RtlFOOWRNaGvua2haaBIkJlgmIxNoKz1BjkE9hq8cIrwiHK8PAwUhAmMhBAQAAAAAAgAA/2oD6ANSABwAKQA+QDsCAQAEGhkYAwIAAkccGwICRAABAAQAAQRgBQMCAAICAFQFAwIAAAJYAAIAAkweHSQjHSkeKSkZEAYFFyslIyc+ATU0JyYnJiIHBgcGFBcWFxYzMjY3FxUBNwEiLgE0PgEyHgEUDgECyi0SLDAzMVRXyldUMTIzMVRWZUV8LxIBHVb9i0Z2RUV2jHZGRXfdEi98RWVWVDEzMzFUVspXVDEzMCwSLf7iVgEdRXeMdkVFdox2RgAAAAAEAAD/qAPoAxQAAwAXABsAJABWQFMAAAEAbwABAgFvAAgJBwkIB20ABwMJBwNrBQEDBgkDBmsKAQIACQgCCWAABgQEBlIABgYEVgAEBgRKBgQjIh8eGxoZGBIQDw4NCwQXBhcREAsFFisTIRUhBSEiBhURFBY7ARUhNTMyNjURNCYBIREhJRQGIiY0NjIW+gH0/gwCsPyVGiUlGrsB9LwaJCT+7P6JAXcBCBsmGhomGwMUfT8kGv7HGiT7+yUZATkaJP2PATnaExoaJhsbAAAAAgAA//oD6QLDACMAJgAfQBwmJSQDAgABRwABAAFvAAACAG8AAgJmPyEVAwUXKwEmJyYnJicmJyIHBgcOAQcGFBcWFxYXFhcWMxY3Njc+ATc2NAERBQPgAw8QGR4mtrXJpiIeGiEDCQkDEBEaHSO5t8akIh0bIgMI/Y8BOAIbJCAlFhkBDQEOBBsYSCNplWkjIyYYHAQMAQ0GGxlIImme/vsBZ7QAAAAAAQAA/7EDZAMLADUAHUAaNSwjGhEIBgABAUcAAQABbwAAAGYpJjsCBRUrAR4BDwEOAS8BFRQGByMiJjc1BwYmLwEmNj8BJy4BPwE+AR8BNTQ2NzMyFh0BNzYWHwEWBg8BAzsaDg4jDzoZlSodRx0sAZQaOg4kDg4blJQaEA8kDzgblCoeRx0qlRo4ECMPEBmUAQgOOho9Gg4OVasdKgEsHKtVDxAZPRo6DlZWDjoaPRoODlWrHSoBLByrVQ8QGT0aOg5WAAIAAP/5A6ADCwAuAEMA3kAKPAEFByYBBgUCR0uwClBYQDwACAEDAQgDbQACAwcDAmUABwUDBwVrAAUGAwUGawAGBAMGBGsAAQADAgEDYAAEAAAEVAAEBABYAAAEAEwbS7ALUFhANwAIAQIBCAJtAAcCBQIHBW0ABQYCBQZrAAYEAgYEawABAwECBwECYAAEAAAEVAAEBABYAAAEAEwbQDwACAEDAQgDbQACAwcDAmUABwUDBwVrAAUGAwUGawAGBAMGBGsAAQADAgEDYAAEAAAEVAAEBABYAAAEAExZWUAMFBcVJzUyJjUzCQUdKwEVFAYjISImNRE0NjchMhceAQ8BBiMiJyYjISIGBxEUFhchMjY9ATQ/ATYzMhcWEwEGIi8BJjQ/ATYyHwEBNjIfARYUAxJeQ/4wQ15eQwHQIx4JAwcbBgcCAw0M/jAlNAE2JAHQJTQFJAYHAwQLgf45DSQO8A4OPQ4kDpMBaQ0kDj4NAUuxQ15eQwHQQl4BDgQTBhwFAQM0Jf4wJTQBNiSNCAUjBgIEAQX+Og4O8A0kDj4NDZMBaQ0NPQ4kAAAAAv/9/7EDXwMLABAAHQArQCgAAwQBAAEDAGAAAQICAVQAAQECWAACAQJMAQAbGhUUCQgAEAEQBQUUKwEiDgMeAj4DNC4CARQOASIuAj4BMh4BAa1JhGA4AjxciI6GXjo6XoYBZXLG6MhuBnq89Lp+AsM4YISShF48BDRmfJp8aDD+n3XEdHTE6sR0dMQAAAAAAwAAAAADEgHtAA8AHwAvACJAHwUDAgEAAAFUBQMCAQEAWAQCAgABAEw1NTU1NTMGBRorExUUBicjIiYnNTQ2NzMyFgUVFAYnIyImNzU0NjczMhYFFRQGJyMiJj0BNDY3MzIW1h4XaxceASAWaxYgAR0gFmsWIAEeF2sXHgEfIBZrFiAgFmsWIAG3axYgAR4XaxceASAWaxYgAR4XaxceASAWaxYgAR4XaxceASAAAAADAAD/+QDXAwsADwAfAC8ALEApAAUABAMFBGAAAwACAQMCYAABAAABVAABAQBYAAABAEw1NTU1NTMGBRorNxUUBgcjIiYnNTQ2FzMyFgMVFAYnIyImJzU0NjczMhYDFRQGKwEiJic1NDY7ATIW1h4XaxceASAWaxYgAR4XaxceASAWaxYgAR4XaxceASAWaxYgmmwWHgEgFWwWIAEeAQZrFiABHhdrFx4BIAEIaxYgIBZrFiAgAAAAAv/9/7EDWQNSACgANAAnQCQAAwIDbwACAQJvAAEAAAFUAAEBAFgAAAEATDMyLSwaGRQEBRUrARQOAiIuAjc0Njc2FhcWBgcOARUUHgIyPgI3NCYnLgE+ARceAQERFAYiJjcRNDYyFgNZRHKgrKJuSgNaURg8EBIIGDY8LFBmeGRUJgM8NhgIIzwXUVr+myo6LAEqPCgBXleedEREdJ5XZrI+EggYFzwRKXhDOmpMLi5MajpEdioSOjAIEj20AUj+mh0qKh0BZh0qKgAAB//6/7ED6gLDAAgASgBYAGYAcwCAAIYAe0B4d3ZAPgQJCHhtbGhnQi0HBQmDeSoDAQCGgHonEgUKBIIVAgsKBUcABwYIBgcIbQACCwMLAgNtAAYACAkGCGAACQAFAAkFYAAAAAEEAAFgAAQACgsECmAACwIDC1QACwsDWAADCwNMZmRfXVhWKhooKCcrGhMQDAUdKwEyFg4BLgI2FwUWBg8BBiInJQcGIxYHDgEHBiMiJyY3PgE3NjMyFzY/AScmJwYjIicuAScmNjc2MzIXHgEXFgcfASU2Mh8BHgEHBTYmJyYjIgcGFhcWMzIDPgEnJiMiBw4BFxYzMhMXNTQ/AScHBg8BBiMfAQEnBRUHHwIWHwEFNyUHBgcCGA4WAhIgEgQaswEbEAURRwcTB/5/PgQDCAIENi9KUEwwMwcENi5KUS4mBQhERAgFJi5RSi42BAMWGS9NUEouOAMCCAc+AYEHEwdHEQUQ/WkaHC00NyoVGhwtMzgpGS0cGhYpODMtHBoVKjeXNhIILA8BBAkBAXg2AZpH/lNZBQQGBAIPAeJH/t5jAQYBXhYcFgISIBIi3gsoCCQEBNglAhwaK1AdLywvRSpQHS8SCAUoKQUHES8dUCohPBYsLx1OLBsbAyXYBQQkCScMTRhKHCEUGEgeIf51HEoXFCEcShcUAXchBxQLBBoOAgQJAYISAUEk8EA1BQMHBQEPsiPkTQICAAAAAAQAAP9qA+gDUgAIABgAGwA3AE5ASxIKAgQDMgECBBsBBQIDRwAHAQABBwBtAAgAAwQIA2AABAACBQQCXgAFAAEHBQFgAAAGBgBSAAAABlgABgAGTDUjNRMXJBMhEAkFHSsFIREjIiY3NSM3NTQmJyEiBhcVFBY3ITI2EzMnBREUBgchIiYnNSEiJicRNDY3ITIWBxUWHwEeAQGtAfTpFiAB1o4KB/53BwwBCggBiQcKj6enAR4gFv3pFx4B/tEXHgEgFgJfFiABDAjkEBZPAWYeF+ihJAcKAQwGJAcMAQr+kafu/okXHgEgFlkgFQLuFx4BIBa3BwjkEDQAAAQAAP+xA1kDCwADACEAMQBFAFFATisqIyIECAQBRw0BBAYBCAJGAAoHAQQICgRgAAgAAwYIA2AABgABAAYBXgUCAgAJCQBSBQICAAAJWAAJAAlMQD04NSYmMxETOxEREAsFHSsXITUhBTMRNCYvAS4BBxUUBiMhIiYnNSMRMzU0NjMhMhYHAzU0JisBIgYXFRQWOwEyNgURFAYjISImJxE0NjMhMhYfAR4B1gGt/lMB9EgMBZ0FHAgeF/6+Fh4BSEggFQHRFiAB1goIawcMAQoIawcMAWQeF/0SFx4BIBYCBRc2D5wQFgfW1gH0CBoHnAYMAegWICAW6P026BYgIBYBHrIICgoIsggKCgr9+hYgIBYC7hYgGA6dDzYAA//5/7EDqQMLAFEAYQBxAFRAUTgBBQFQAQQFDw0MAwIGA0cABgcCBwYCbQACAwcCA2sAAQAFBAEFYAAEAAcGBAdgAAMAAANUAAMDAFgAAAMATG5sZmReXFZVS0hFQj06NQgFFSsBFgcDDgEHISImJyY/ATY3NCY1Nj8BPgE3NiY2PwE+ATc2Jjc2PwE+ATc0Jj4BPwI+AT8BPgIXFTYzITIWBwMOAQchIgYXFjMhMjY3EzYnFgUGFhchMjY/ATYmJyEiBg8BBhYXITI2PwE2JgchIgYHA5MWDJoKQCX9/StQDw4NAQECBAEEEg0YBQIEBAcKDBYDAQQCAgoNChoDBAIIBgoJBQYGCwUUFBAVBwGpKSwMmBQoNP4bDwwFDkMCAxAeBKgEARX9ugIGCAFTCA4CDAIIB/6tBw4COgMIBwFTBw4DCwMIB/6tCAwEAkcgKP4HJDABPCwlIg8NBwUOBAYGGhU8FQYWCwkNFD4UBRgEBwoNDkIVBBQJDAcLEQoUChIICgIEAQVAKP4GQiYBEQ8nEg4CJg0TCBEHCgEMBiQHCgEMBrMHCgEMBiQHDAEKCAAAAAP////3BHcCwwAQACEANgAnQCQABQIBAAEFAGADAQEEBAFUAwEBAQRYAAQBBEw3OCUoFxQGBRorATQuAiIOAhQeAjI+AiU0LgIrAR4BDgEHMzI+AjcUDgInISIuAz4CNyEyHgICgy5ManRqTC4uTGp0akwuAawsTmo52ENOAkpF2DpoUCpJOl6GR/5TSIRgOAI8XIhGAa1IhGA4AV46akwuLkxqdGpMLi5Majo6akwuM5SulDMuTGo6SYRePAI4YoCWgGQ0AjhghAAAAAIAAP/3BHgCwwAUACUAKkAnAAAAAwIAA2AEAQIBAQJUBAECAgFYAAECAUwWFR4dFSUWJTc0BQUWKxE0PgIzITIeAw4CJyEiLgIFMj4DLgIiDgIeAzpehkcBrUiEYDgCPFyIRv5TSIRgOAMROmhQKgIuTGxwbkgyBCpQZgFeSYRgODhghJKEXjwCOGKA0y5ManRqTC4uTGp0akwuAAP///+xA6EDCwAGAA0AHQA5QDYEAQABAUcABQIBAQAFAV4DBgIABAQAVAMGAgAABFgABAAETAEAHBkUEQsKCQgDAgAGAQYHBRQrFyERIREUFiURIREhMjYTERQGByEiJjcRNDY3ITIWWQFU/poMAwb+mwFTCApINiT9EiQ2ATQlAu4lNAcCg/2PCAoSAnH9fQoCrv1aJTQBNiQCpiU0ATYAAAAACv////kDoQMLAA8AHwAvAD8ATwBfAG8AfwCPAJ8AekB3iYFpYTk4MQcHBnlxSUEZEQYDAllRKSEJCAEHAQADRwATEAwCBgcTBmARDQIHDggCAgMHAmAPCQIDCgQCAAEDAGALBQIBEhIBVAsFAgEBElgAEgESTJ6blpONi4WDfXt1c21rZWNdW1VTTUsmJiYmJiYmJiMUBR0rJTU0JisBIgYXFRQWOwEyNj0BNCYrASIGFxUUFjsBMjYFNTQmKwEiBh0BFBY7ATI2ATU0JisBIgYXFRQWOwEyNgU1NCYrASIGHQEUFjsBMjYFNTQmKwEiBh0BFBY7ATI2ATU0JisBIgYdARQWOwEyNgU1NCYrASIGHQEUFjsBMjY9ATQmKwEiBh0BFBY7ATI2NxEUBiMhIiY3ETQ2NyEyFgEeCgizBwwBCgizCAoKCLMHDAEKCLMICgEdCgezCAoKCLMHCv7jCgizBwwBCgizCAoBHQoHswgKCgizBwoBHgoIsggKCgiyCAr+4goHswgKCgizBwoBHgoIsggKCgiyCAoKCLIICgoIsggKSDYk/RIkNgE0JQLuJTRSawgKCghrCAoK3mwHCgoHbAcKCs9rCAoKCGsICgoBtWsICgoIawgKCs9sBwoKB2wHCgrPawgKCghrCAoKAbVrCAoKCGsICgrPbAcKCgdsBwoK3msICgoIawgKCrr9oSU0NCUCXyU0ATYAA//9/7EDXwMLAAgAFQAiADxAOQABAgACAQBtAAADAgADawAFBgECAQUCYAADBAQDVAADAwRYAAQDBEwKCSAfGhkQDwkVChUTEgcFFisBFAYiLgE2MhYnIg4CHgEyPgEuAgEUDgEiLgI+ATIeAQI7UnhSAlZ0VpBTjFACVIiqhlYETo4BW3LG6MhuBnq89Lp+AV47VFR2VFT1UoykjFJSjKSMUv7QdcR0dMTqxHR0xAAFAAD/sQR3AwsAAwAHAA0AEQAVAGZAYwAFCgVvDwEKAwpvDAEDCANvDgEIAQhvCwEBAAFvCQcCAwAGAG8NAQYEBAZSDQEGBgRWAAQGBEoSEg4OCAgEBAAAEhUSFRQTDhEOERAPCA0IDQwLCgkEBwQHBgUAAwADERAFFSsBESMRAREjEQEVIREzEQERIxElESMRAWWPAWWOAsr7iUcCy48BZY8BXv7iAR4BHv3EAjz9fUgDWvzuAfT+UwGt1v19AoMAAAAAAgAA/7EEdwMLAAUACwA0QDELCgkDAwEBRwABAwFvAAMCA28EAQIAAAJSBAECAgBWAAACAEoAAAgHAAUABRERBQUWKwUVIREzEQETIRETAQR3+4lHA1qO/GD6AUEHSANa/O4CO/4MAUIBQf6/AAAAAAP//v+xA8QDUgALABAAFgAuQCsAAQIDEAECAAICRwAEAQRvAAEDAW8AAwIDbwACAAJvAAAAZhEUERUjBQUZKwkBDgEHIi4CPgEzEyEUBgcTIREyHgEBrQEwO55XdcZwBHi+eWgBr0I9XP5TdcR0AWH+0D1CAXTE6sR0/lNYnjsBeAGtcsYAAAACAAD/sQR3AwsABQAfAEtASBgLAgQFFxIQAwMEEQECAwNHAAEFAW8ABQQFbwAEAwRvAAMCA28GAQIAAAJSBgECAgBWAAACAEoAAB0bFRQODQAFAAUREQcFFisFFSERMxEBFRQGLwEBBiIvAQcnATYyHwEBJyY2OwEyFgR3+4lHA+gUCkT+nwYOBoLoawFGBg4GggEDQwkIDfMHCgdIA1r87gK48gwKCUT+nwYGgulsAUYGBoIBA0MJFgoAAAH/+/+tA14DEABDABpAFz85NC8pJB8ZEwsFCwBFAAAAZhEQAQUUKwEXFgYPARcWBwYvAQcGBwYjIi8BBwYnJi8BBwYnJj8BJy4BPwEnJjY/AScmNzYfATc+AR8BNzYWHwE3NhcWDwEXHgEHAwBNEQ0WaR4GERAXaBsFFwcEEQtLTA8YFwUbaBcQEQcdaRYNEU1NEQ0WaR0HERAXaBsFLhBMSxAuBRtoFxARBh5pFg0RAV5LEC4GG2cXEBIHHmkXBwENTU0RBQcXaR4HEhAXZxsGLhBLSxAuBhtnFxASBx1oFw0STU0RDBdoHQcSEBdnGwYuEAAEAAD/zgPUAu4ACAAQABgAIABbQFggHRwDBQQUAQIFGBUMAwMCEA0CAAMERwAGAAcEBgdgAAQABQIEBWAAAgADAAIDYAgBAAEBAFQIAQAAAVgAAQABTAEAHx4bGhcWExIPDgsKBQQACAEICQUUKyUyFhQGIiY0Nic2MhcHJiIHJzYgFwcmIAcnNiAXByYgBwHqKjo6Ujo6qlj0WEY6pDrSkgGakEZ0/rp20swCPspGrv4UrpY8Ujo6UjxwWFhIOjrUlJRGdnbUzs5GsLAAAAAAAgAA//kDEwMLAA8AHwArQCgAAwQBAAEDAGAAAQICAVQAAQECWAACAQJMAgAeGxYTCgcADwIPBQUUKwEhIgYHERQWFyEyNjURNCYXERQGIyEiJjURNDY3ITIWAnH+MCU0ATYkAdAlNDR8XkP+MENeXkMB0EJgAsM0Jf4wJTQBNiQB0CU0Wf4wQ15eQwHQQl4BYAAAAAQAAP/5A1kC5wAJABEAGgBFAGVAYjoBAgMuHAIGCQJHDAELBAEDAgsDYAUPAgIAAAJUDQoCAAkJAFQOAQkIAQYBCQZgAAEHBwFUAAEBB1gABwEHTAsKQ0JCQT48ODYzMjIwKikmIyAeGRcVFA4NChELETMREAUWKyURIxEUFhczMjYDMycmIgYeASU0JgYPATMyNhcVFAYrARUUBgchIiY9ASMiJj0BNDY7ASImNDY3Mh8BNzYzMh4BBiczMhYCBrMUEGsQFP9tRg8uIAIcAZgeLw9FbBYg0QoINSAW/aEWIDUICgoI9TNKSjM8IkhHIjw0SAJMMvUICl0BkP5wDg4BEAHkWhEeLh41FiABEVogebMHCukWHgEgFekKB7MICkhqRgIrXFwrSmZMAgoAAAAC////sQQvA1IADwAvADVAMgkBAgEAIAEDAgJHAAMCA3AABQAAAQUAXgABAgIBVAABAQJYBAECAQJMNSY2JiYUBgUaKwERNCYnISIGBxEUFjMhMjYTERQGByEUHgEXFAYjISImJzQ+ATUhIiY3ETQ2MyEyFgPoCgj8gwcKAQwGA30HDEY0Jf7REhABFA/+4g8UARIS/tAkNgE0JQN9JTQBKAHRBwoBDAb+LwcKCgHY/aElNAEULiIHDhYWDggiLBU2JAJfJTQ0AAT////5BC8CwwAPAB8AKgAyAFVAUhkRAgIDAUcAAQADAgEDXgACCAEABAIAYAkBBAAHBgQHYAoBBgUFBlQKAQYGBVgABQYFTCwrISABADAtKzIsMSckICohKh0cFRMJBgAPAQ4LBRQrNyImNRE0NjMhMhYXERQGIwERFBY3ITI2NRE0JichIgYBMxUUBgchIiY3NQUyNCsBIhQz6CU0NCUCXyU0ATYk/Y8MBgJfCAoKCP2hBwoC/1k0JfyDJDYBAkQJCVkJCYg0JQGJJTQ0Jf53JTQB4v53BwwBCggBiQcKAQz99DYWHgEgFTY2EhIAAAP////5AoQDCwAIABgAKABeQAwSEQoDAgEAAQMAAkdLsAxQWEAeAAMAAANkAAQAAQIEAWAAAgAAAlQAAgIAWAAAAgBMG0AdAAMAA3AABAABAgQBYAACAAACVAACAgBYAAACAExZtzU2JikSBQUZKyU0LgEOARY+ATcRNCYjISIGBxEUFjMhMjYTERQGIyEiJjcRNDY3ITIWAWUUIBICFhwY1AoH/i8HCgEMBgHRBwpINCX+LyQ2ATQlAdEkNkAPFAIYGhgEEGsCFwgKCgj96QgKCgIf/aElNDQlAl8lNAE2AAAAAAQAAP/5Aa0CwwAIABgAIQAxAEJAPxIKCQMDAgABAQACRwAHAAQFBwRgAAUAAgMFAmAAAwAAAQMAYAABBgYBVAABAQZYAAYBBkw1NDE0JiUTEggFHCslNCYiDgEeATY3ETQmIyEiBhURFBYzITI2AzQrASIUOwEyNxEUBiMhIiY1ETQ2MyEyFgEDGiYYAhwiHnIKCP7iBwoKBwEeBwxsCVkJCVkJoSwc/uIdKiodAR4dKkATGhomGAIcawGICAoKCP54CAoKAeEJEhL9xB0qKh0CPB0qKgAAAAEAAAAAANwBzAAIACBAHQIBAAEBAFQCAQAAAVgAAQABTAEABQQACAEIAwUUKxMyFhQGIiY0Nm4uQEBcQEABzEBaQkJaQAAAAAH//wAAAnEClwAIABhAFQIBAAEAbwABAWYBAAUEAAgBCAMFFCsBMhYQBiQmEjYBOYK2tv78uAK0Ape4/v64ArQBBrQAAgAAAAADjwKtAAoAFQAtQCoEAQADAG8HAQMCA28GAQIBAQJUBgECAgFYBQEBAgFMEhETERIRExAIBRwrEyERFAYnNTI2JyMBIREUBic1MjYnIxIBT8SLXIQB3wIuAU/Ei1yEAd8Crf6yjMQBb4JeAU7+sozEAW+CXgAAAAIAAAAAA48CrQAKABUAL0AsBwEDAgACAwBtBAEAAG4FAQECAgFUBQEBAQJYBgECAQJMEhETERIRExAIBRwrJSERNDY3FSIGFTMBIRE0NjcVIgYVMwOP/rHGiV2C3/3S/rHEi12C3xABT4vCAW+EW/6xAU+LwgFvhFsAAAAB/+D/YgLAA1YAMgAhQB4SAQABAUctJggGBAUARAABAAFvAAAAZhkYFxYCBRQrFwYnJjc2NyY3HgI2LgE3PgE3DgEWFzI2NzYWFxYGBw4BBwYXFjcOAgcGFjcOAwc8BhQSAgQuZDAKLCwSEAYcFnQuGBIKEAyQIi6IDgwYHCzMDBAcNno4oGgCBGowHkIqbh6KFAwIGmR+mqIgXEQInq5GLGQULmA8AvACBEIgGG4cLCQGChgwHFBECAYYPBA4OA4IBAAABAAA/28DQgNNAAsAFQAgACkAS0BIEQYCBUQHAQEGAQAEAQBgCQEECAECAwQCYAADBQUDVAADAwVYAAUDBUwiIRcWDQwBACYlISkiKRwbFiAXIAwVDRUACwELCgUUKwEiBwYUHwE3NhAnJicyFhIHCQEmEDYTIgYUFxYyNzY0JicyFhQOAS4BNgGggF1bW93fWlpdgq7yAnv+2f7be/aqNE4nJmwmJ042S2xslmoCbgLlWlj+WdvbWAEAV1po8P6seP7eASJ4AVTw/uJOaiclJSdqTjRqmGoCbpRuAAH//f+OAa8DUgAWAB9AHAwBAQIBRwACAQJvAwEBAAFvAAAAZiQjJBQEBRgrJRYPAQYiLwEmNjsBETQ2OwEyFhURMzIBqwQHwwYPBcYICgt9CghrCAp9C30KCdcFBdcJFQK4CAoKCP1IAAAAAAEAAAAAA+gCNwAVAB5AGwEBAAEBRwABAAABUgABAQBYAAABAEwdIwIFFisBFRQGIyEVFAYvASY0PwE2Fh0BITIWA+gKCP1IFgjXBQXXCRUCuAgKAZRsBwp9DAoIxAUPBsUICQx9CgAAAQAAAAADxAI4ABYAHkAbDAEAAQFHAAEAAAFUAAEBAFYAAAEASiYXAgUWKwEUDwEGJj0BISImPQE0NjMhNTQ2HwEWA8QF1wkV/UgICgoIArgWCNcFAWAIBsUICQx9CgdsBwp9DAoIwwYAAAAAAf/+/2oBrwMuABYAH0AcBAEBAAFHAAMAA28CAQABAG8AAQFmFCQjIQQFGCsBBisBERQGKwEiJjURIyImPwE2Mh8BFgGrBQt9CghrCAp9DAgHwwUPBsYHAj8L/UgICgoIArgWCNcFBdcJAAAAAQAAAAEAACLyP2BfDzz1AAsD6AAAAADTxkZtAAAAANPGRm3/4P8hBNcDmwAAAAgAAgAAAAAAAAABAAADUv9qAAAFBf/g//IE1wABAAAAAAAAAAAAAAAAAAAAwQPoAAAD6P/9A+gAAAMgAAADWf/9AxEAAALKAAADEQAABHYAAAMRAAADWf//BHYAAAPoAAAEdgAAA+gAAANZAAADWQAAAjsAAAR2AAADWf/9A+gAAANZAAACOwAAA1kAAANZAAACygAAA+gAAAOgAAACygAAA6AAAAPoAAADWQAAAxEAAANZ//8EdgAAA1kAAAR2AAAD6AAABHYAAANZAAADWQAAA+gAAANZAAAD6AAAAxH//wPoAAAEcQAAAsoAAAPoAAAFBQAAA1kAAAR2AAADWQAABHYAAAR2AAADWQAAA6AAAAPoAAADEQAAA+gAAAQvAAACygAAA1kAAAI7AAAD6AAAA6AAAANZAAAEL///BHYAAANZAAAD6P/+A6AAAAPo//4DEf/+A1kAAANZAAADWQAAA1n//QNZAAAD6AAAA5gAAALWAAADhAAAAv4AAAPoAAAD6AAAA+gAAAPoAAADYv/zAdH/9AHR//MDYP/0AwwAAAPoAAAD6P/6A4QAAAPoAAAD6AAAA+gAAAPeAAADdQAABC8AAAMRAAACggAAA6AAAAKCAAADoAAAA6AAAAOgAAAD6AAAA+j//wOgAAADoAAAAxEAAAR2AAAEdgAABC///wPoAAADEQAAAxEAAAMRAAADWf/9A1n//QNZ//0DWf/9AjsAAANZ//0DWf/9AWUAAAFlAAADWf/9AdL/8wEJ//QBCf/zAdD/9AL4AAAD6AAAA+gAAAPoAAAD6AAAA+gAAAPo//YD6P//A+gAAAPoAAAELwAAA+j//QPoAAAD6P//A6D//wOgAAAD6AAAA+gAAAPoAAAD6AAAA+gAAAOgAAADoAAAA1n//QMRAAAA1gAAA1n//QPo//oD6AAAA1kAAAOg//kEdv//BHYAAAOg//8DoP//A1n//QR2AAAEdgAAA+j//gR2AAADWf/7A9QAAAMRAAADWQAABC///wQv//8Cgv//AawAAADcAAACcf//A6AAAAOgAAACuv/gA0EAAAGs//0D6AAAA+gAAAGs//4AAAAAAKYCMgKQAtIDuATkBWgGZgcaB2YIaAjWCnAKqgryCz4LfgwGDNANFg5yDqwO/A9WD9gQ9hGcEkoTFhO6FAwUVhTUFWwWOhbeF3oYEBh2HMgdBB2yHegerB9KIS4htiJmI94kHCTQJ7woGijGKXwqJCraK0gr2Cw+LMotNC2CLeQuVC7EL6IwXjEOMdgyGDL4M0gz+DZENpA2sjdqN/w4mDkIOVQ6ADpAOrQ7GjuaO7474jwGPCg8ZjzkPYw97D5GPrg/ED+KQBhAikEAQUhBmkIAQmZDQkRARHRFAEVGRaBF8EacRzxIAEg4SIJIykj0SUZJrEoUSlJK2ktgS9hMPEyGTPBNEE0wTVBNbE20Tc5N6E6OTu5PjlCCURhSUlL2U2ZVKlZmWBBYmFk2WaBaBlpqWtJbJluIXF5cplz+XVpdwF7QX05f3GC2YRxhamG8YspjImOEY7xkAGReZNhlQGWKZiJmhmb+Z3Bn3GgAaCJoYGieaQBpbmmkadhqDmpDAAEAAADBAd0AJwAAAAAAAgC6AMoAcwAAAfkLcAAAAAAAAAASAN4AAQAAAAAAAAA1AAAAAQAAAAAAAQAQADUAAQAAAAAAAgAHAEUAAQAAAAAAAwAQAEwAAQAAAAAABAAQAFwAAQAAAAAABQALAGwAAQAAAAAABgAQAHcAAQAAAAAACgArAIcAAQAAAAAACwATALIAAwABBAkAAABqAMUAAwABBAkAAQAgAS8AAwABBAkAAgAOAU8AAwABBAkAAwAgAV0AAwABBAkABAAgAX0AAwABBAkABQAWAZ0AAwABBAkABgAgAbMAAwABBAkACgBWAdMAAwABBAkACwAmAilDb3B5cmlnaHQgKEMpIDIwMTYgYnkgb3JpZ2luYWwgYXV0aG9ycyBAIGZvbnRlbGxvLmNvbXRyeF9hZGRvbnNfaWNvbnNSZWd1bGFydHJ4X2FkZG9uc19pY29uc3RyeF9hZGRvbnNfaWNvbnNWZXJzaW9uIDEuMHRyeF9hZGRvbnNfaWNvbnNHZW5lcmF0ZWQgYnkgc3ZnMnR0ZiBmcm9tIEZvbnRlbGxvIHByb2plY3QuaHR0cDovL2ZvbnRlbGxvLmNvbQBDAG8AcAB5AHIAaQBnAGgAdAAgACgAQwApACAAMgAwADEANgAgAGIAeQAgAG8AcgBpAGcAaQBuAGEAbAAgAGEAdQB0AGgAbwByAHMAIABAACAAZgBvAG4AdABlAGwAbABvAC4AYwBvAG0AdAByAHgAXwBhAGQAZABvAG4AcwBfAGkAYwBvAG4AcwBSAGUAZwB1AGwAYQByAHQAcgB4AF8AYQBkAGQAbwBuAHMAXwBpAGMAbwBuAHMAdAByAHgAXwBhAGQAZABvAG4AcwBfAGkAYwBvAG4AcwBWAGUAcgBzAGkAbwBuACAAMQAuADAAdAByAHgAXwBhAGQAZABvAG4AcwBfAGkAYwBvAG4AcwBHAGUAbgBlAHIAYQB0AGUAZAAgAGIAeQAgAHMAdgBnADIAdAB0AGYAIABmAHIAbwBtACAARgBvAG4AdABlAGwAbABvACAAcAByAG8AagBlAGMAdAAuAGgAdAB0AHAAOgAvAC8AZgBvAG4AdABlAGwAbABvAC4AYwBvAG0AAAAAAgAAAAAAAAAKAAAAAAAAAAAAAAAAAAAAAAAAAAAAAADBAQIBAwEEAQUBBgEHAQgBCQEKAQsBDAENAQ4BDwEQAREBEgETARQBFQEWARcBGAEZARoBGwEcAR0BHgEfASABIQEiASMBJAElASYBJwEoASkBKgErASwBLQEuAS8BMAExATIBMwE0ATUBNgE3ATgBOQE6ATsBPAE9AT4BPwFAAUEBQgFDAUQBRQFGAUcBSAFJAUoBSwFMAU0BTgFPAVABUQFSAVMBVAFVAVYBVwFYAVkBWgFbAVwBXQFeAV8BYAFhAWIBYwFkAWUBZgFnAWgBaQFqAWsBbAFtAW4BbwFwAXEBcgFzAXQBdQF2AXcBeAF5AXoBewF8AX0BfgF/AYABgQGCAYMBhAGFAYYBhwGIAYkBigGLAYwBjQGOAY8BkAGRAZIBkwGUAZUBlgGXAZgBmQGaAZsBnAGdAZ4BnwGgAaEBogGjAaQBpQGmAacBqAGpAaoBqwGsAa0BrgGvAbABsQGyAbMBtAG1AbYBtwG4AbkBugG7AbwBvQG+Ab8BwAHBAcIABXNwaW4zBXNwaW41BXNoYXJlA2FkbgdhbmRyb2lkCWFuZ2VsbGlzdAVhcHBsZQdiZWhhbmNlCWJpdGJ1Y2tldApidXlzZWxsYWRzAmNjCGNvZGVvcGVuDmNvbm5lY3RkZXZlbG9wBGNzczMIZGFzaGN1YmUJZGVsaWNpb3VzCmRldmlhbnRhcnQEZGlnZwhkcmliYmJsZQdkcm9wYm94BmRydXBhbAhmYWNlYm9vawZmbGlja3IIZm9ydW1iZWUKZm91cnNxdWFyZQNnaXQGZ2l0aHViBmdvb2dsZQVncGx1cwdnd2FsbGV0C2hhY2tlci1uZXdzBWh0bWw1CWluc3RhZ3JhbQdpb3hob3N0Bmpvb21sYQhqc2ZpZGRsZQZsYXN0Zm0HbGVhbnB1YghsaW5rZWRpbgVsaW51eAZtYXhjZG4IbWVhbnBhdGgGb3BlbmlkCXBhZ2VsaW5lcwZwYXlwYWwOcGllZC1waXBlci1hbHQJcGludGVyZXN0AnFxBnJlZGRpdAZyZW5yZW4Gc2VsbHN5DHNoaXJ0c2luYnVsawtzaW1wbHlidWlsdAhza3lhdGxhcwVza3lwZQVzbGFjawpzbGlkZXNoYXJlDXN0YWNrb3ZlcmZsb3cFc3RlYW0Lc3R1bWJsZXVwb24NdGVuY2VudC13ZWlibwZ0cmVsbG8GdHVtYmxyBnR3aXRjaAd0d2l0dGVyBHZpbmUJdmtvbnRha3RlBndlY2hhdAh3aGF0c2FwcAV3ZWlibwd3aW5kb3dzCXdvcmRwcmVzcwR4aW5nBHllbHAHeW91dHViZQV5YWhvbwZjaXJjbGUFbGVtb24Kc291bmRjbG91ZA5nb29nbGUtY2lyY2xlcwdsb2dvLWRiBnN3ZWRlbghldmVybm90ZQVoZWFydAtoZWFydC1lbXB0eQNleWUHY29tbWVudARkb3duBGxlZnQFcmlnaHQCdXAGcGVuY2lsCXNoYXJlYWJsZQV0b29scwZiYXNrZXQFcmVwbHkJcmVwbHktYWxsB2ZvcndhcmQEZWRpdAhmZWF0aGVyMwRjb2RlBmF0dGFjaARsb2NrCWxvY2stb3BlbgNwaW4EaG9tZQRsaW5rBnVubGluawhkb3dubG9hZARtYWlsBHN0YXIKc3Rhci1lbXB0eQh1c2VyLWFsdAl1c2VyLXBsdXMKdXNlci10aW1lcwt1c2Vycy1ncm91cAJvawZkZWxldGUEcGx1cwVtaW51cwpvay1jaXJjbGVkDmNhbmNlbC1jaXJjbGVkDHBsdXMtY2lyY2xlZA1taW51cy1jaXJjbGVkBGhlbHAMaGVscC1jaXJjbGVkDGluZm8tY2lyY2xlZARpbmZvCWF0dGVudGlvbhFhdHRlbnRpb24tY2lyY2xlZAlkb3duLW1pbmkJbGVmdC1taW5pCnJpZ2h0LW1pbmkHdXAtbWluaQNyc3MLc2xpZGVyLWxlZnQMc2xpZGVyLXJpZ2h0BXN3b3JkA2dwcwdtb25pdG9yBW1vdXNlB2ZlYXRoZXIJYnV0dGVyZmx5BmZsb3dlcgZjYW1lcmEEbGFtcAdnbGFzc2VzCXRlbGVwaG9uZQVwcmludAZleHBvcnQEbXV0ZQZ2b2x1bWUGc2VhcmNoBnByaW50Mgh5b3V0dWJlMghhc3RlcmlzawhjaGVja2JveAtjaXJjbGUtdGhpbghlbGxpcHNpcw1lbGxpcHNpcy12ZXJ0A29mZghzY2lzc29ycwVwYXN0ZQZmbG9wcHkEYm9vawp0b2dnbGUtb2ZmCXRvZ2dsZS1vbgdjb2x1bW5zBXRhYmxlCmNpcmNsZS1kb3QJY2hhcnQtYmFyCmNoYXJ0LWFyZWEJY2hhcnQtcGllCmNoYXJ0LWxpbmULY2VydGlmaWNhdGUGc2lnbmFsDmNoZWNrYm94LWVtcHR5BGdpZnQHZGVza3RvcAZsYXB0b3AGdGFibGV0Bm1vYmlsZQNkb3QGcmVjb3JkC3F1b3RlLXJpZ2h0CnF1b3RlLWxlZnQIZmVhdGhlcjIQbG9jYXRpb24tb3V0bGluZQphcnJvdy1kb3duCmFycm93LWxlZnQLYXJyb3ctcmlnaHQIYXJyb3ctdXAAAAAAAQAB//8ADwAAAAAAAAAAAAAAAAAAAAAAGAAYABgAGAOb/yEDm/8hsAAsILAAVVhFWSAgS7gADlFLsAZTWliwNBuwKFlgZiCKVViwAiVhuQgACABjYyNiGyEhsABZsABDI0SyAAEAQ2BCLbABLLAgYGYtsAIsIGQgsMBQsAQmWrIoAQpDRWNFUltYISMhG4pYILBQUFghsEBZGyCwOFBYIbA4WVkgsQEKQ0VjRWFksChQWCGxAQpDRWNFILAwUFghsDBZGyCwwFBYIGYgiophILAKUFhgGyCwIFBYIbAKYBsgsDZQWCGwNmAbYFlZWRuwAStZWSOwAFBYZVlZLbADLCBFILAEJWFkILAFQ1BYsAUjQrAGI0IbISFZsAFgLbAELCMhIyEgZLEFYkIgsAYjQrEBCkNFY7EBCkOwAWBFY7ADKiEgsAZDIIogirABK7EwBSWwBCZRWGBQG2FSWVgjWSEgsEBTWLABKxshsEBZI7AAUFhlWS2wBSywB0MrsgACAENgQi2wBiywByNCIyCwACNCYbACYmawAWOwAWCwBSotsAcsICBFILALQ2O4BABiILAAUFiwQGBZZrABY2BEsAFgLbAILLIHCwBDRUIqIbIAAQBDYEItsAkssABDI0SyAAEAQ2BCLbAKLCAgRSCwASsjsABDsAQlYCBFiiNhIGQgsCBQWCGwABuwMFBYsCAbsEBZWSOwAFBYZVmwAyUjYUREsAFgLbALLCAgRSCwASsjsABDsAQlYCBFiiNhIGSwJFBYsAAbsEBZI7AAUFhlWbADJSNhRESwAWAtsAwsILAAI0KyCwoDRVghGyMhWSohLbANLLECAkWwZGFELbAOLLABYCAgsAxDSrAAUFggsAwjQlmwDUNKsABSWCCwDSNCWS2wDywgsBBiZrABYyC4BABjiiNhsA5DYCCKYCCwDiNCIy2wECxLVFixBGREWSSwDWUjeC2wESxLUVhLU1ixBGREWRshWSSwE2UjeC2wEiyxAA9DVVixDw9DsAFhQrAPK1mwAEOwAiVCsQwCJUKxDQIlQrABFiMgsAMlUFixAQBDYLAEJUKKiiCKI2GwDiohI7ABYSCKI2GwDiohG7EBAENgsAIlQrACJWGwDiohWbAMQ0ewDUNHYLACYiCwAFBYsEBgWWawAWMgsAtDY7gEAGIgsABQWLBAYFlmsAFjYLEAABMjRLABQ7AAPrIBAQFDYEItsBMsALEAAkVUWLAPI0IgRbALI0KwCiOwAWBCIGCwAWG1EBABAA4AQkKKYLESBiuwcisbIlktsBQssQATKy2wFSyxARMrLbAWLLECEystsBcssQMTKy2wGCyxBBMrLbAZLLEFEystsBossQYTKy2wGyyxBxMrLbAcLLEIEystsB0ssQkTKy2wHiwAsA0rsQACRVRYsA8jQiBFsAsjQrAKI7ABYEIgYLABYbUQEAEADgBCQopgsRIGK7ByKxsiWS2wHyyxAB4rLbAgLLEBHistsCEssQIeKy2wIiyxAx4rLbAjLLEEHistsCQssQUeKy2wJSyxBh4rLbAmLLEHHistsCcssQgeKy2wKCyxCR4rLbApLCA8sAFgLbAqLCBgsBBgIEMjsAFgQ7ACJWGwAWCwKSohLbArLLAqK7AqKi2wLCwgIEcgILALQ2O4BABiILAAUFiwQGBZZrABY2AjYTgjIIpVWCBHICCwC0NjuAQAYiCwAFBYsEBgWWawAWNgI2E4GyFZLbAtLACxAAJFVFiwARawLCqwARUwGyJZLbAuLACwDSuxAAJFVFiwARawLCqwARUwGyJZLbAvLCA1sAFgLbAwLACwAUVjuAQAYiCwAFBYsEBgWWawAWOwASuwC0NjuAQAYiCwAFBYsEBgWWawAWOwASuwABa0AAAAAABEPiM4sS8BFSotsDEsIDwgRyCwC0NjuAQAYiCwAFBYsEBgWWawAWNgsABDYTgtsDIsLhc8LbAzLCA8IEcgsAtDY7gEAGIgsABQWLBAYFlmsAFjYLAAQ2GwAUNjOC2wNCyxAgAWJSAuIEewACNCsAIlSYqKRyNHI2EgWGIbIVmwASNCsjMBARUUKi2wNSywABawBCWwBCVHI0cjYbAJQytlii4jICA8ijgtsDYssAAWsAQlsAQlIC5HI0cjYSCwBCNCsAlDKyCwYFBYILBAUVizAiADIBuzAiYDGllCQiMgsAhDIIojRyNHI2EjRmCwBEOwAmIgsABQWLBAYFlmsAFjYCCwASsgiophILACQ2BkI7ADQ2FkUFiwAkNhG7ADQ2BZsAMlsAJiILAAUFiwQGBZZrABY2EjICCwBCYjRmE4GyOwCENGsAIlsAhDRyNHI2FgILAEQ7ACYiCwAFBYsEBgWWawAWNgIyCwASsjsARDYLABK7AFJWGwBSWwAmIgsABQWLBAYFlmsAFjsAQmYSCwBCVgZCOwAyVgZFBYIRsjIVkjICCwBCYjRmE4WS2wNyywABYgICCwBSYgLkcjRyNhIzw4LbA4LLAAFiCwCCNCICAgRiNHsAErI2E4LbA5LLAAFrADJbACJUcjRyNhsABUWC4gPCMhG7ACJbACJUcjRyNhILAFJbAEJUcjRyNhsAYlsAUlSbACJWG5CAAIAGNjIyBYYhshWWO4BABiILAAUFiwQGBZZrABY2AjLiMgIDyKOCMhWS2wOiywABYgsAhDIC5HI0cjYSBgsCBgZrACYiCwAFBYsEBgWWawAWMjICA8ijgtsDssIyAuRrACJUZSWCA8WS6xKwEUKy2wPCwjIC5GsAIlRlBYIDxZLrErARQrLbA9LCMgLkawAiVGUlggPFkjIC5GsAIlRlBYIDxZLrErARQrLbA+LLA1KyMgLkawAiVGUlggPFkusSsBFCstsD8ssDYriiAgPLAEI0KKOCMgLkawAiVGUlggPFkusSsBFCuwBEMusCsrLbBALLAAFrAEJbAEJiAuRyNHI2GwCUMrIyA8IC4jOLErARQrLbBBLLEIBCVCsAAWsAQlsAQlIC5HI0cjYSCwBCNCsAlDKyCwYFBYILBAUVizAiADIBuzAiYDGllCQiMgR7AEQ7ACYiCwAFBYsEBgWWawAWNgILABKyCKimEgsAJDYGQjsANDYWRQWLACQ2EbsANDYFmwAyWwAmIgsABQWLBAYFlmsAFjYbACJUZhOCMgPCM4GyEgIEYjR7ABKyNhOCFZsSsBFCstsEIssDUrLrErARQrLbBDLLA2KyEjICA8sAQjQiM4sSsBFCuwBEMusCsrLbBELLAAFSBHsAAjQrIAAQEVFBMusDEqLbBFLLAAFSBHsAAjQrIAAQEVFBMusDEqLbBGLLEAARQTsDIqLbBHLLA0Ki2wSCywABZFIyAuIEaKI2E4sSsBFCstsEkssAgjQrBIKy2wSiyyAABBKy2wSyyyAAFBKy2wTCyyAQBBKy2wTSyyAQFBKy2wTiyyAABCKy2wTyyyAAFCKy2wUCyyAQBCKy2wUSyyAQFCKy2wUiyyAAA+Ky2wUyyyAAE+Ky2wVCyyAQA+Ky2wVSyyAQE+Ky2wViyyAABAKy2wVyyyAAFAKy2wWCyyAQBAKy2wWSyyAQFAKy2wWiyyAABDKy2wWyyyAAFDKy2wXCyyAQBDKy2wXSyyAQFDKy2wXiyyAAA/Ky2wXyyyAAE/Ky2wYCyyAQA/Ky2wYSyyAQE/Ky2wYiywNysusSsBFCstsGMssDcrsDsrLbBkLLA3K7A8Ky2wZSywABawNyuwPSstsGYssDgrLrErARQrLbBnLLA4K7A7Ky2waCywOCuwPCstsGkssDgrsD0rLbBqLLA5Ky6xKwEUKy2wayywOSuwOystsGwssDkrsDwrLbBtLLA5K7A9Ky2wbiywOisusSsBFCstsG8ssDorsDsrLbBwLLA6K7A8Ky2wcSywOiuwPSstsHIsswkEAgNFWCEbIyFZQiuwCGWwAyRQeLABFTAtAEu4AMhSWLEBAY5ZsAG5CAAIAGNwsQAFQrIAAQAqsQAFQrMKAgEIKrEABUKzDgABCCqxAAZCugLAAAEACSqxAAdCugBAAAEACSqxAwBEsSQBiFFYsECIWLEDZESxJgGIUVi6CIAAAQRAiGNUWLEDAERZWVlZswwCAQwquAH/hbAEjbECAEQAAA==") format("truetype");}@font-face{font-family:vcpb-plugin-icons;font-weight:400;font-style:normal;src:url("data:font/woff2;vcpb-plugin-icons.ttf;base64,d09GMgABAAAAAAHEAAoAAAAAAzAAAAF7AAEAAAAAAAAAAAAAAAAAAAAAAAAAAAAABmAARAqBHIEhCwgAATYCJAMMBCAFgRQHIBt+AkAvDmxjUYsz2S2cjjTio0/KHOLhv7XX+2Y2QLQqBBYtqwifExcV/YWLKpCx4BrhP+kC69ru/W8TeR3vHkkkfqSZJ5ja3SyUYJLiOhASmJmebF1Wm6BoUpPUawnJVN+y5Y5/v5//HvgwzBNOsS2LJcAw/HlUbJEG4EGdbHdF8pNFwYHc8SnUQXqVxmPG8ddB9EhODHNPqb/e56onp9kIJSBcBrnOCy0LLaxSZwnpRqsq6KvPU9KcpfOnezgBFICQcn8ZEbfVjmz1oqHWHDBt6MmPjV6cX1v7Exxs+2JfnV2ae63W2GQKz25ShCwFzFLENAPIfvWqXi//xDWHyFbgFzlxiyIILIUQRQmCwnMdrf0/EEi8+3qqzx3+66YCtFfjha3qqedy6JZA8LS5ng9U/3uufMgFErygJpA9MwqSWXW6xoqiRyjZSAaVyErSAh0m7T72TiUejKER272Ns7mlHdudMbBzVJiaO9sYOmhMHRwtgR3Vvm27MgA=") format("truetype");}@font-face{font-family:vc_grid_v1;font-weight:400;font-style:normal;src:url("data:font/woff2;vc_grid_v1.ttf;base64,d09GMgABAAAAAAEsAAoAAAAAAoQAAADkAAEAAAAAAAAAAAAAAAAAAAAAAAAAAAAABmAANAoQNAsGAAE2AiQDCAQgBYEGByAb7wEYLgrsxgdDXEE02onXptTmeQ8QFlG0bNWz+09KH90pQVIhahwOITEaLREOjEGvtfPqTcOnXf20GqwSn5SoF8Ok/8HDG+YC3GmqadZDLk5kN/DgxQPUgCCxPAotmBzSnYw1tJJvM/KST3Bf/Nv6AOXUlFuM03A0mUAAMAEKDQskWHAm0HXBNLjXBUCBjqChAzogLQmAINu404+Ty3cV+Lnh2HjkF7sKhPyNKJAhAICCQFDeESgAAMy9Iel7YgFPObagWUDuzKz4988twJcq68zQZI+IVHdNhUmUOYZtYSIQZAAA") format("truetype");}@font-face{font-family:"Damion";font-style:normal;font-weight:400;src:url("https://fonts.gstatic.com/s/damion/v14/hv-XlzJ3KEUe_YZkamw2EzJwVw.woff2") format("woff2");unicode-range:U+0000-00FF,U+0131,U+0152-0153,U+02BB-02BC,U+02C6,U+02DA,U+02DC,U+2000-206F,U+2074,U+20AC,U+2122,U+2191,U+2193,U+2212,U+2215,U+FEFF,U+FFFD;}@font-face{font-family:"Josefin Sans";font-style:italic;font-weight:400;src:url("https://fonts.gstatic.com/s/josefinsans/v25/Qw3EZQNVED7rKGKxtqIqX5EUCEx1XHgOiJM6xPE.woff2") format("woff2");unicode-range:U+0102-0103,U+0110-0111,U+0128-0129,U+0168-0169,U+01A0-01A1,U+01AF-01B0,U+1EA0-1EF9,U+20AB;}@font-face{font-family:"Josefin Sans";font-style:italic;font-weight:400;src:url("https://fonts.gstatic.com/s/josefinsans/v25/Qw3EZQNVED7rKGKxtqIqX5EUCEx0XHgOiJM6xPE.woff2") format("woff2");unicode-range:U+0100-024F,U+0259,U+1E00-1EFF,U+2020,U+20A0-20AB,U+20AD-20CF,U+2113,U+2C60-2C7F,U+A720-A7FF;}@font-face{font-family:"Josefin Sans";font-style:italic;font-weight:400;src:url("https://fonts.gstatic.com/s/josefinsans/v25/Qw3EZQNVED7rKGKxtqIqX5EUCEx6XHgOiJM6.woff2") format("woff2");unicode-range:U+0000-00FF,U+0131,U+0152-0153,U+02BB-02BC,U+02C6,U+02DA,U+02DC,U+2000-206F,U+2074,U+20AC,U+2122,U+2191,U+2193,U+2212,U+2215,U+FEFF,U+FFFD;}@font-face{font-family:"Josefin Sans";font-style:italic;font-weight:700;src:url("https://fonts.gstatic.com/s/josefinsans/v25/Qw3EZQNVED7rKGKxtqIqX5EUCEx1XHgOiJM6xPE.woff2") format("woff2");unicode-range:U+0102-0103,U+0110-0111,U+0128-0129,U+0168-0169,U+01A0-01A1,U+01AF-01B0,U+1EA0-1EF9,U+20AB;}@font-face{font-family:"Josefin Sans";font-style:italic;font-weight:700;src:url("https://fonts.gstatic.com/s/josefinsans/v25/Qw3EZQNVED7rKGKxtqIqX5EUCEx0XHgOiJM6xPE.woff2") format("woff2");unicode-range:U+0100-024F,U+0259,U+1E00-1EFF,U+2020,U+20A0-20AB,U+20AD-20CF,U+2113,U+2C60-2C7F,U+A720-A7FF;}@font-face{font-family:"Josefin Sans";font-style:italic;font-weight:700;src:url("https://fonts.gstatic.com/s/josefinsans/v25/Qw3EZQNVED7rKGKxtqIqX5EUCEx6XHgOiJM6.woff2") format("woff2");unicode-range:U+0000-00FF,U+0131,U+0152-0153,U+02BB-02BC,U+02C6,U+02DA,U+02DC,U+2000-206F,U+2074,U+20AC,U+2122,U+2191,U+2193,U+2212,U+2215,U+FEFF,U+FFFD;}@font-face{font-family:"Josefin Sans";font-style:normal;font-weight:300;src:url("https://fonts.gstatic.com/s/josefinsans/v25/Qw3aZQNVED7rKGKxtqIqX5EUAnx4Vn8siqM7.woff2") format("woff2");unicode-range:U+0102-0103,U+0110-0111,U+0128-0129,U+0168-0169,U+01A0-01A1,U+01AF-01B0,U+1EA0-1EF9,U+20AB;}@font-face{font-family:"Josefin Sans";font-style:normal;font-weight:300;src:url("https://fonts.gstatic.com/s/josefinsans/v25/Qw3aZQNVED7rKGKxtqIqX5EUA3x4Vn8siqM7.woff2") format("woff2");unicode-range:U+0100-024F,U+0259,U+1E00-1EFF,U+2020,U+20A0-20AB,U+20AD-20CF,U+2113,U+2C60-2C7F,U+A720-A7FF;}@font-face{font-family:"Josefin Sans";font-style:normal;font-weight:300;src:url("https://fonts.gstatic.com/s/josefinsans/v25/Qw3aZQNVED7rKGKxtqIqX5EUDXx4Vn8sig.woff2") format("woff2");unicode-range:U+0000-00FF,U+0131,U+0152-0153,U+02BB-02BC,U+02C6,U+02DA,U+02DC,U+2000-206F,U+2074,U+20AC,U+2122,U+2191,U+2193,U+2212,U+2215,U+FEFF,U+FFFD;}@font-face{font-family:"Josefin Sans";font-style:normal;font-weight:400;src:url("https://fonts.gstatic.com/s/josefinsans/v25/Qw3aZQNVED7rKGKxtqIqX5EUAnx4Vn8siqM7.woff2") format("woff2");unicode-range:U+0102-0103,U+0110-0111,U+0128-0129,U+0168-0169,U+01A0-01A1,U+01AF-01B0,U+1EA0-1EF9,U+20AB;}@font-face{font-family:"Josefin Sans";font-style:normal;font-weight:400;src:url("https://fonts.gstatic.com/s/josefinsans/v25/Qw3aZQNVED7rKGKxtqIqX5EUA3x4Vn8siqM7.woff2") format("woff2");unicode-range:U+0100-024F,U+0259,U+1E00-1EFF,U+2020,U+20A0-20AB,U+20AD-20CF,U+2113,U+2C60-2C7F,U+A720-A7FF;}@font-face{font-family:"Josefin Sans";font-style:normal;font-weight:400;src:url("https://fonts.gstatic.com/s/josefinsans/v25/Qw3aZQNVED7rKGKxtqIqX5EUDXx4Vn8sig.woff2") format("woff2");unicode-range:U+0000-00FF,U+0131,U+0152-0153,U+02BB-02BC,U+02C6,U+02DA,U+02DC,U+2000-206F,U+2074,U+20AC,U+2122,U+2191,U+2193,U+2212,U+2215,U+FEFF,U+FFFD;}@font-face{font-family:"Josefin Sans";font-style:normal;font-weight:700;src:url("https://fonts.gstatic.com/s/josefinsans/v25/Qw3aZQNVED7rKGKxtqIqX5EUAnx4Vn8siqM7.woff2") format("woff2");unicode-range:U+0102-0103,U+0110-0111,U+0128-0129,U+0168-0169,U+01A0-01A1,U+01AF-01B0,U+1EA0-1EF9,U+20AB;}@font-face{font-family:"Josefin Sans";font-style:normal;font-weight:700;src:url("https://fonts.gstatic.com/s/josefinsans/v25/Qw3aZQNVED7rKGKxtqIqX5EUA3x4Vn8siqM7.woff2") format("woff2");unicode-range:U+0100-024F,U+0259,U+1E00-1EFF,U+2020,U+20A0-20AB,U+20AD-20CF,U+2113,U+2C60-2C7F,U+A720-A7FF;}@font-face{font-family:"Josefin Sans";font-style:normal;font-weight:700;src:url("https://fonts.gstatic.com/s/josefinsans/v25/Qw3aZQNVED7rKGKxtqIqX5EUDXx4Vn8sig.woff2") format("woff2");unicode-range:U+0000-00FF,U+0131,U+0152-0153,U+02BB-02BC,U+02C6,U+02DA,U+02DC,U+2000-206F,U+2074,U+20AC,U+2122,U+2191,U+2193,U+2212,U+2215,U+FEFF,U+FFFD;}@font-face{font-family:"PT Sans";font-style:italic;font-weight:400;src:url("https://fonts.gstatic.com/s/ptsans/v17/jizYRExUiTo99u79D0e0ysmIAjcQ-woy.woff2") format("woff2");unicode-range:U+0460-052F,U+1C80-1C88,U+20B4,U+2DE0-2DFF,U+A640-A69F,U+FE2E-FE2F;}@font-face{font-family:"PT Sans";font-style:italic;font-weight:400;src:url("https://fonts.gstatic.com/s/ptsans/v17/jizYRExUiTo99u79D0e0w8mIAjcQ-woy.woff2") format("woff2");unicode-range:U+0301,U+0400-045F,U+0490-0491,U+04B0-04B1,U+2116;}@font-face{font-family:"PT Sans";font-style:italic;font-weight:400;src:url("https://fonts.gstatic.com/s/ptsans/v17/jizYRExUiTo99u79D0e0ycmIAjcQ-woy.woff2") format("woff2");unicode-range:U+0100-024F,U+0259,U+1E00-1EFF,U+2020,U+20A0-20AB,U+20AD-20CF,U+2113,U+2C60-2C7F,U+A720-A7FF;}@font-face{font-family:"PT Sans";font-style:italic;font-weight:400;src:url("https://fonts.gstatic.com/s/ptsans/v17/jizYRExUiTo99u79D0e0x8mIAjcQ-w.woff2") format("woff2");unicode-range:U+0000-00FF,U+0131,U+0152-0153,U+02BB-02BC,U+02C6,U+02DA,U+02DC,U+2000-206F,U+2074,U+20AC,U+2122,U+2191,U+2193,U+2212,U+2215,U+FEFF,U+FFFD;}@font-face{font-family:"PT Sans";font-style:italic;font-weight:700;src:url("https://fonts.gstatic.com/s/ptsans/v17/jizdRExUiTo99u79D0e8fOydIhUd0TA7i2bI.woff2") format("woff2");unicode-range:U+0460-052F,U+1C80-1C88,U+20B4,U+2DE0-2DFF,U+A640-A69F,U+FE2E-FE2F;}@font-face{font-family:"PT Sans";font-style:italic;font-weight:700;src:url("https://fonts.gstatic.com/s/ptsans/v17/jizdRExUiTo99u79D0e8fOydKxUd0TA7i2bI.woff2") format("woff2");unicode-range:U+0301,U+0400-045F,U+0490-0491,U+04B0-04B1,U+2116;}@font-face{font-family:"PT Sans";font-style:italic;font-weight:700;src:url("https://fonts.gstatic.com/s/ptsans/v17/jizdRExUiTo99u79D0e8fOydIRUd0TA7i2bI.woff2") format("woff2");unicode-range:U+0100-024F,U+0259,U+1E00-1EFF,U+2020,U+20A0-20AB,U+20AD-20CF,U+2113,U+2C60-2C7F,U+A720-A7FF;}@font-face{font-family:"PT Sans";font-style:italic;font-weight:700;src:url("https://fonts.gstatic.com/s/ptsans/v17/jizdRExUiTo99u79D0e8fOydLxUd0TA7iw.woff2") format("woff2");unicode-range:U+0000-00FF,U+0131,U+0152-0153,U+02BB-02BC,U+02C6,U+02DA,U+02DC,U+2000-206F,U+2074,U+20AC,U+2122,U+2191,U+2193,U+2212,U+2215,U+FEFF,U+FFFD;}@font-face{font-family:"PT Sans";font-style:normal;font-weight:400;src:url("https://fonts.gstatic.com/s/ptsans/v17/jizaRExUiTo99u79D0-ExcOPIDUg-g.woff2") format("woff2");unicode-range:U+0460-052F,U+1C80-1C88,U+20B4,U+2DE0-2DFF,U+A640-A69F,U+FE2E-FE2F;}@font-face{font-family:"PT Sans";font-style:normal;font-weight:400;src:url("https://fonts.gstatic.com/s/ptsans/v17/jizaRExUiTo99u79D0aExcOPIDUg-g.woff2") format("woff2");unicode-range:U+0301,U+0400-045F,U+0490-0491,U+04B0-04B1,U+2116;}@font-face{font-family:"PT Sans";font-style:normal;font-weight:400;src:url("https://fonts.gstatic.com/s/ptsans/v17/jizaRExUiTo99u79D0yExcOPIDUg-g.woff2") format("woff2");unicode-range:U+0100-024F,U+0259,U+1E00-1EFF,U+2020,U+20A0-20AB,U+20AD-20CF,U+2113,U+2C60-2C7F,U+A720-A7FF;}@font-face{font-family:"PT Sans";font-style:normal;font-weight:400;src:url("https://fonts.gstatic.com/s/ptsans/v17/jizaRExUiTo99u79D0KExcOPIDU.woff2") format("woff2");unicode-range:U+0000-00FF,U+0131,U+0152-0153,U+02BB-02BC,U+02C6,U+02DA,U+02DC,U+2000-206F,U+2074,U+20AC,U+2122,U+2191,U+2193,U+2212,U+2215,U+FEFF,U+FFFD;}@font-face{font-family:"PT Sans";font-style:normal;font-weight:700;src:url("https://fonts.gstatic.com/s/ptsans/v17/jizfRExUiTo99u79B_mh0OOtLR8a8zILig.woff2") format("woff2");unicode-range:U+0460-052F,U+1C80-1C88,U+20B4,U+2DE0-2DFF,U+A640-A69F,U+FE2E-FE2F;}@font-face{font-family:"PT Sans";font-style:normal;font-weight:700;src:url("https://fonts.gstatic.com/s/ptsans/v17/jizfRExUiTo99u79B_mh0OqtLR8a8zILig.woff2") format("woff2");unicode-range:U+0301,U+0400-045F,U+0490-0491,U+04B0-04B1,U+2116;}@font-face{font-family:"PT Sans";font-style:normal;font-weight:700;src:url("https://fonts.gstatic.com/s/ptsans/v17/jizfRExUiTo99u79B_mh0OCtLR8a8zILig.woff2") format("woff2");unicode-range:U+0100-024F,U+0259,U+1E00-1EFF,U+2020,U+20A0-20AB,U+20AD-20CF,U+2113,U+2C60-2C7F,U+A720-A7FF;}@font-face{font-family:"PT Sans";font-style:normal;font-weight:700;src:url("https://fonts.gstatic.com/s/ptsans/v17/jizfRExUiTo99u79B_mh0O6tLR8a8zI.woff2") format("woff2");unicode-range:U+0000-00FF,U+0131,U+0152-0153,U+02BB-02BC,U+02C6,U+02DA,U+02DC,U+2000-206F,U+2074,U+20AC,U+2122,U+2191,U+2193,U+2212,U+2215,U+FEFF,U+FFFD;}@font-face{font-family:"fontello";font-weight:normal;font-style:normal;src:url("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/source/rev-7c1dd13/wp-content/themes/isida/css/fontello/font/03f70c4e51bb097564d6f260409f71c0.fontello.svg#fontello") format("svg");}@font-face{font-family:"fontello";src:url("data:application/octet-stream;base64,AAEAAAAPAIAAAwBwR1NVQiCMJXkAAAD8AAAAVE9TLzI+O0pZAAABUAAAAFZjbWFwpvRAkAAAAagAABKWY3Z0IAbx/s4AAbvUAAAAIGZwZ22KkZBZAAG79AAAC3BnYXNwAAAAEAABu8wAAAAIZ2x5ZlL2EFcAABRAAAGPgmhlYWQMdKwRAAGjxAAAADZoaGVhCC4FhwABo/wAAAAkaG10eE4O/pAAAaQgAAAE7GxvY2H3imAhAAGpDAAAAnhtYXhwBCIN1wABq4QAAAAgbmFtZcydHB4AAaukAAACzXBvc3RTA2EFAAGudAAADVVwcmVw5UErvAABx2QAAACGAAEAAAAKADAAPgACbGF0bgAOREZMVAAaAAQAAAAAAAAAAQAAAAQAAAAAAAAAAQAAAAFsaWdhAAgAAAABAAAAAQAEAAQAAAABAAgAAQAGAAAAAQAAAAEDfwGQAAUAAAJ6ArwAAACMAnoCvAAAAeAAMQECAAACAAUDAAAAAAAAAAAAAAAAAAAAAAAAAAAAAFBmRWQAQOgA6T0DUv9qAFoDYACxAAAAAQAAAAAAAAAAAAUAAAADAAAALAAAAAQAAAPOAAEAAAAAAsgAAwABAAAALAADAAoAAAPOAAQCnAAAAAYABAABAALpHuk9//8AAOgA6SP//wAAAAAAAQAGAkIAAAABAAIAAwAEAAUABgAHAAgACQAKAAsADAANAA4ADwAQABEAEgATABQAFQAWABcAGAAZABoAGwAcAB0AHgAfACAAIQAiACMAJAAlACYAJwAoACkAKgArACwALQAuAC8AMAAxADIAMwA0ADUANgA3ADgAOQA6ADsAPAA9AD4APwBAAEEAQgBDAEQARQBGAEcASABJAEoASwBMAE0ATgBPAFAAUQBSAFMAVABVAFYAVwBYAFkAWgBbAFwAXQBeAF8AYABhAGIAYwBkAGUAZgBnAGgAaQBqAGsAbABtAG4AbwBwAHEAcgBzAHQAdQB2AHcAeAB5AHoAewB8AH0AfgB/AIAAgQCCAIMAhACFAIYAhwCIAIkAigCLAIwAjQCOAI8AkACRAJIAkwCUAJUAlgCXAJgAmQCaAJsAnACdAJ4AnwCgAKEAogCjAKQApQCmAKcAqACpAKoAqwCsAK0ArgCvALAAsQCyALMAtAC1ALYAtwC4ALkAugC7ALwAvQC+AL8AwADBAMIAwwDEAMUAxgDHAMgAyQDKAMsAzADNAM4AzwDQANEA0gDTANQA1QDWANcA2ADZANoA2wDcAN0A3gDfAOAA4QDiAOMA5ADlAOYA5wDoAOkA6gDrAOwA7QDuAO8A8ADxAPIA8wD0APUA9gD3APgA+QD6APsA/AD9AP4A/wEAAQEBAgEDAQQBBQEGAQcBCAEJAQoBCwEMAQ0BDgEPARABEQESARMBFAEVARYBFwEYARkBGgEbARwBHQEeAR8BIAEhASIBIwEkASUBJgEnASgBKQEqASsBLAEtAS4BLwEwATEBMgEzATQBNQE2ATcBOAE5AToAAAEGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAwAAAAADsgAAAAAAAABOgAA6AAAAOgAAAAAAQAA6AEAAOgBAAAAAgAA6AIAAOgCAAAAAwAA6AMAAOgDAAAABAAA6AQAAOgEAAAABQAA6AUAAOgFAAAABgAA6AYAAOgGAAAABwAA6AcAAOgHAAAACAAA6AgAAOgIAAAACQAA6AkAAOgJAAAACgAA6AoAAOgKAAAACwAA6AsAAOgLAAAADAAA6AwAAOgMAAAADQAA6A0AAOgNAAAADgAA6A4AAOgOAAAADwAA6A8AAOgPAAAAEAAA6BAAAOgQAAAAEQAA6BEAAOgRAAAAEgAA6BIAAOgSAAAAEwAA6BMAAOgTAAAAFAAA6BQAAOgUAAAAFQAA6BUAAOgVAAAAFgAA6BYAAOgWAAAAFwAA6BcAAOgXAAAAGAAA6BgAAOgYAAAAGQAA6BkAAOgZAAAAGgAA6BoAAOgaAAAAGwAA6BsAAOgbAAAAHAAA6BwAAOgcAAAAHQAA6B0AAOgdAAAAHgAA6B4AAOgeAAAAHwAA6B8AAOgfAAAAIAAA6CAAAOggAAAAIQAA6CEAAOghAAAAIgAA6CIAAOgiAAAAIwAA6CMAAOgjAAAAJAAA6CQAAOgkAAAAJQAA6CUAAOglAAAAJgAA6CYAAOgmAAAAJwAA6CcAAOgnAAAAKAAA6CgAAOgoAAAAKQAA6CkAAOgpAAAAKgAA6CoAAOgqAAAAKwAA6CsAAOgrAAAALAAA6CwAAOgsAAAALQAA6C0AAOgtAAAALgAA6C4AAOguAAAALwAA6C8AAOgvAAAAMAAA6DAAAOgwAAAAMQAA6DEAAOgxAAAAMgAA6DIAAOgyAAAAMwAA6DMAAOgzAAAANAAA6DQAAOg0AAAANQAA6DUAAOg1AAAANgAA6DYAAOg2AAAANwAA6DcAAOg3AAAAOAAA6DgAAOg4AAAAOQAA6DkAAOg5AAAAOgAA6DoAAOg6AAAAOwAA6DsAAOg7AAAAPAAA6DwAAOg8AAAAPQAA6D0AAOg9AAAAPgAA6D4AAOg+AAAAPwAA6D8AAOg/AAAAQAAA6EAAAOhAAAAAQQAA6EEAAOhBAAAAQgAA6EIAAOhCAAAAQwAA6EMAAOhDAAAARAAA6EQAAOhEAAAARQAA6EUAAOhFAAAARgAA6EYAAOhGAAAARwAA6EcAAOhHAAAASAAA6EgAAOhIAAAASQAA6EkAAOhJAAAASgAA6EoAAOhKAAAASwAA6EsAAOhLAAAATAAA6EwAAOhMAAAATQAA6E0AAOhNAAAATgAA6E4AAOhOAAAATwAA6E8AAOhPAAAAUAAA6FAAAOhQAAAAUQAA6FEAAOhRAAAAUgAA6FIAAOhSAAAAUwAA6FMAAOhTAAAAVAAA6FQAAOhUAAAAVQAA6FUAAOhVAAAAVgAA6FYAAOhWAAAAVwAA6FcAAOhXAAAAWAAA6FgAAOhYAAAAWQAA6FkAAOhZAAAAWgAA6FoAAOhaAAAAWwAA6FsAAOhbAAAAXAAA6FwAAOhcAAAAXQAA6F0AAOhdAAAAXgAA6F4AAOheAAAAXwAA6F8AAOhfAAAAYAAA6GAAAOhgAAAAYQAA6GEAAOhhAAAAYgAA6GIAAOhiAAAAYwAA6GMAAOhjAAAAZAAA6GQAAOhkAAAAZQAA6GUAAOhlAAAAZgAA6GYAAOhmAAAAZwAA6GcAAOhnAAAAaAAA6GgAAOhoAAAAaQAA6GkAAOhpAAAAagAA6GoAAOhqAAAAawAA6GsAAOhrAAAAbAAA6GwAAOhsAAAAbQAA6G0AAOhtAAAAbgAA6G4AAOhuAAAAbwAA6G8AAOhvAAAAcAAA6HAAAOhwAAAAcQAA6HEAAOhxAAAAcgAA6HIAAOhyAAAAcwAA6HMAAOhzAAAAdAAA6HQAAOh0AAAAdQAA6HUAAOh1AAAAdgAA6HYAAOh2AAAAdwAA6HcAAOh3AAAAeAAA6HgAAOh4AAAAeQAA6HkAAOh5AAAAegAA6HoAAOh6AAAAewAA6HsAAOh7AAAAfAAA6HwAAOh8AAAAfQAA6H0AAOh9AAAAfgAA6H4AAOh+AAAAfwAA6H8AAOh/AAAAgAAA6IAAAOiAAAAAgQAA6IEAAOiBAAAAggAA6IIAAOiCAAAAgwAA6IMAAOiDAAAAhAAA6IQAAOiEAAAAhQAA6IUAAOiFAAAAhgAA6IYAAOiGAAAAhwAA6IcAAOiHAAAAiAAA6IgAAOiIAAAAiQAA6IkAAOiJAAAAigAA6IoAAOiKAAAAiwAA6IsAAOiLAAAAjAAA6IwAAOiMAAAAjQAA6I0AAOiNAAAAjgAA6I4AAOiOAAAAjwAA6I8AAOiPAAAAkAAA6JAAAOiQAAAAkQAA6JEAAOiRAAAAkgAA6JIAAOiSAAAAkwAA6JMAAOiTAAAAlAAA6JQAAOiUAAAAlQAA6JUAAOiVAAAAlgAA6JYAAOiWAAAAlwAA6JcAAOiXAAAAmAAA6JgAAOiYAAAAmQAA6JkAAOiZAAAAmgAA6JoAAOiaAAAAmwAA6JsAAOibAAAAnAAA6JwAAOicAAAAnQAA6J0AAOidAAAAngAA6J4AAOieAAAAnwAA6J8AAOifAAAAoAAA6KAAAOigAAAAoQAA6KEAAOihAAAAogAA6KIAAOiiAAAAowAA6KMAAOijAAAApAAA6KQAAOikAAAApQAA6KUAAOilAAAApgAA6KYAAOimAAAApwAA6KcAAOinAAAAqAAA6KgAAOioAAAAqQAA6KkAAOipAAAAqgAA6KoAAOiqAAAAqwAA6KsAAOirAAAArAAA6KwAAOisAAAArQAA6K0AAOitAAAArgAA6K4AAOiuAAAArwAA6K8AAOivAAAAsAAA6LAAAOiwAAAAsQAA6LEAAOixAAAAsgAA6LIAAOiyAAAAswAA6LMAAOizAAAAtAAA6LQAAOi0AAAAtQAA6LUAAOi1AAAAtgAA6LYAAOi2AAAAtwAA6LcAAOi3AAAAuAAA6LgAAOi4AAAAuQAA6LkAAOi5AAAAugAA6LoAAOi6AAAAuwAA6LsAAOi7AAAAvAAA6LwAAOi8AAAAvQAA6L0AAOi9AAAAvgAA6L4AAOi+AAAAvwAA6L8AAOi/AAAAwAAA6MAAAOjAAAAAwQAA6MEAAOjBAAAAwgAA6MIAAOjCAAAAwwAA6MMAAOjDAAAAxAAA6MQAAOjEAAAAxQAA6MUAAOjFAAAAxgAA6MYAAOjGAAAAxwAA6McAAOjHAAAAyAAA6MgAAOjIAAAAyQAA6MkAAOjJAAAAygAA6MoAAOjKAAAAywAA6MsAAOjLAAAAzAAA6MwAAOjMAAAAzQAA6M0AAOjNAAAAzgAA6M4AAOjOAAAAzwAA6M8AAOjPAAAA0AAA6NAAAOjQAAAA0QAA6NEAAOjRAAAA0gAA6NIAAOjSAAAA0wAA6NMAAOjTAAAA1AAA6NQAAOjUAAAA1QAA6NUAAOjVAAAA1gAA6NYAAOjWAAAA1wAA6NcAAOjXAAAA2AAA6NgAAOjYAAAA2QAA6NkAAOjZAAAA2gAA6NoAAOjaAAAA2wAA6NsAAOjbAAAA3AAA6NwAAOjcAAAA3QAA6N0AAOjdAAAA3gAA6N4AAOjeAAAA3wAA6N8AAOjfAAAA4AAA6OAAAOjgAAAA4QAA6OEAAOjhAAAA4gAA6OIAAOjiAAAA4wAA6OMAAOjjAAAA5AAA6OQAAOjkAAAA5QAA6OUAAOjlAAAA5gAA6OYAAOjmAAAA5wAA6OcAAOjnAAAA6AAA6OgAAOjoAAAA6QAA6OkAAOjpAAAA6gAA6OoAAOjqAAAA6wAA6OsAAOjrAAAA7AAA6OwAAOjsAAAA7QAA6O0AAOjtAAAA7gAA6O4AAOjuAAAA7wAA6O8AAOjvAAAA8AAA6PAAAOjwAAAA8QAA6PEAAOjxAAAA8gAA6PIAAOjyAAAA8wAA6PMAAOjzAAAA9AAA6PQAAOj0AAAA9QAA6PUAAOj1AAAA9gAA6PYAAOj2AAAA9wAA6PcAAOj3AAAA+AAA6PgAAOj4AAAA+QAA6PkAAOj5AAAA+gAA6PoAAOj6AAAA+wAA6PsAAOj7AAAA/AAA6PwAAOj8AAAA/QAA6P0AAOj9AAAA/gAA6P4AAOj+AAAA/wAA6P8AAOj/AAABAAAA6QAAAOkAAAABAQAA6QEAAOkBAAABAgAA6QIAAOkCAAABAwAA6QMAAOkDAAABBAAA6QQAAOkEAAABBQAA6QUAAOkFAAABBgAA6QYAAOkGAAABBwAA6QcAAOkHAAABCAAA6QgAAOkIAAABCQAA6QkAAOkJAAABCgAA6QoAAOkKAAABCwAA6QsAAOkLAAABDAAA6QwAAOkMAAABDQAA6Q0AAOkNAAABDgAA6Q4AAOkOAAABDwAA6Q8AAOkPAAABEAAA6RAAAOkQAAABEQAA6REAAOkRAAABEgAA6RIAAOkSAAABEwAA6RMAAOkTAAABFAAA6RQAAOkUAAABFQAA6RUAAOkVAAABFgAA6RYAAOkWAAABFwAA6RcAAOkXAAABGAAA6RgAAOkYAAABGQAA6RkAAOkZAAABGgAA6RoAAOkaAAABGwAA6RsAAOkbAAABHAAA6RwAAOkcAAABHQAA6R0AAOkdAAABHgAA6R4AAOkeAAABHwAA6SMAAOkjAAABIAAA6SQAAOkkAAABIQAA6SUAAOklAAABIgAA6SYAAOkmAAABIwAA6ScAAOknAAABJAAA6SgAAOkoAAABJQAA6SkAAOkpAAABJgAA6SoAAOkqAAABJwAA6SsAAOkrAAABKAAA6SwAAOksAAABKQAA6S0AAOktAAABKgAA6S4AAOkuAAABKwAA6S8AAOkvAAABLAAA6TAAAOkwAAABLQAA6TEAAOkxAAABLgAA6TIAAOkyAAABLwAA6TMAAOkzAAABMAAA6TQAAOk0AAABMQAA6TUAAOk1AAABMgAA6TYAAOk2AAABMwAA6TcAAOk3AAABNAAA6TgAAOk4AAABNQAA6TkAAOk5AAABNgAA6ToAAOk6AAABNwAA6TsAAOk7AAABOAAA6TwAAOk8AAABOQAA6T0AAOk9AAABOgAAAAYAAP/OA+gC7gAPABMAFwAbAB8AMgBwQG0gAQQFAUcMAQAAAgkAAl4LEAIJAAgHCQheDwEHAAYFBwZeDgEFCgEEAwUEXg0BAwEBA1INAQMDAVgAAQMBTBwcGBgUFBAQAQArKiIhHB8cHx4dGBsYGxoZFBcUFxYVEBMQExIRCQYADwEOEQUUKwEyFhURFAYjISImNRE0NjMBESERJRUjNTcVIzU3FSM1ARcjNDM2NTQmNTQyFRQGFRQWFwOEKjo6KvzgKDw8KAMg/OABXvr6+vr6AlQE+gZUNrQ4KhYC7joq/agoPDwoAlgqOv1EAlj9qMRaWpZaWpZaWv7ARkYWLBBQMG5uMFAQFCAGAAACAAD/agKDAwsACwAuADxAOQcBAgEAAUcAAwIDcAAHCAYCAAEHAGAJBQIBAgIBVAkFAgEBAlgEAQIBAkwtLBMzERQiMxUVEwoFHSsBNTQmIgYdARQWMjYFFAYnIwMOAQcjIicDIyImJzQ2MxEiLgE2NyEyFhQGJxEyFgEMChAKChAKAXcWDu8dAQoGAQ8CK+EPFAFYNx0qAi4bAWUdKiodN1gBcPoICgoI+ggKCr0OFgH+8gcIAQ8BDxQPRW4BHio6KgEsOCwB/uJuAAABAAAAAAOEArIADgAmQCMFAQABAUcGAQFFBAEARAABAAABVAABAQBYAAABAEwUEgIFFislLgEjFQkBFTIeBBcDhFb00P6WAWpanGpWNCQGCpha2gFOAULANlZoaFYaAAACAAAAAAPoArIABQASAC1AKhEEAQMBAAFHEgUAAwBFEAwDAgQBRAAAAQEAVAAAAAFYAAEAAUwXFgIFFisBBxcVCQEXMh4CHwEuASMVCQEBatTU/pYBavponEouBARWpIr+lgFqAiy8xIoBTgFCwGSQkDIymljaAU4BQgAAAQAAAAADhAKyAAwAJ0AkCwEAAQFHCgEBRQwDAgBEAAEAAAFUAAEBAFgAAAEATBcQAgUWKyUiBgc+BDM1CQECHNL0VgQSUm7KfAFo/pj8WpgUQqiAasD+vv6yAAADAAD/tgPUAwgAFQApAC0AkEuwCVBYQDIAAgEBAmMHAQUJCAkFCG0DAQEKAQAEAQBhCwEEAAkFBAleAAgGBghSAAgIBlYABggGShtAMQACAQJvBwEFCQgJBQhtAwEBCgEABAEAYQsBBAAJBQQJXgAIBgYIUgAICAZWAAYIBkpZQB8XFgEALSwrKiMhIB8eHBYpFygODAsKCQcAFQEUDAUUKxMiNzY3Mj4BOwE1IRUzMh4BMxYHBiMXMhYdARQGKwEXITcjIiY9ATQ2MxMhAyFCGgQECAJeXAwsAXwuDFpeAhIGBBAKFCIiFGQs/QgsYhQkJBSaAjBG/lwCDhYKBCIelpYeIggSCjgmFq4WJvr6JhauFib+RAFEAAAAAA4AAAAAA+gCigAPABMAFwAbAB8AIwAnACsALwAzADcAOwA/AEMArECpHAEAGiAPHwseBx0IAwIAA14kGw4KBgUCGRAMCAQEBQIEXhgRDQkEBRYUAhITBRJeIxciFSEFEwEBE1IjFyIVIQUTEwFYAAETAUxAQDg4NDQwMCgoICAYGBAQAQBAQ0BDQkE/Pj08ODs4Ozo5NDc0NzY1MDMwMzIxLy4tLCgrKCsqKScmJSQgIyAjIiEfHh0cGBsYGxoZFxYVFBATEBMSEQkGAA8BDiUFFCsBMhYVERQGIyEiJjURNDYzBRUzNRcjFTMlFTM1FyMVMyUVMzUXIxUzJRUzNRcjFTMHNSMVITUhFSE1IxUnMzUjNzUjFQOiHCoqHPykHCoqHAHgZDJkZP7UZDJkZP7UZDJkZP7UZDJkZDJkAor+DAKKZDJkZJbIAooqHP40HigoHgHMHCpkZGSWZPpkZJZk+mRklmT6ZGSWZJZkZGRkZGSWZDJkZAACAAAAAALFAqAAAgAFAAi1BQMCAAItKwkCJy0BAsX+LAHURv7tARMCoP6+/r6Fvb0AAAAAAwAA/5IDmAMqAAgAEQAXAElARhYVFBMEAgQBRwcBBAMCAwQCbQUBAAADBAADYAYBAgEBAlQGAQICAVgAAQIBTBISCgkBABIXEhcODQkRChEFBAAIAQgIBRQrATIAEAAgABAAEzI2ECYgBhAWExUXBycRAcy+AQ7+8v6E/vIBDr6W0tL+1tTUuJYyqgMq/vL+hP7yAQ4BfAEO/MzUASrS0v7W1AJs9JYyqgESAAMAAP9qAjADUgAbACgAYgB8QBA1MgICAzYBBAJYTQIABgNHS7AkUFhAJgAFBAYEBQZtAAYABAYAawAAAG4AAgAEBQIEYAADAwFYAAEBDANJG0ArAAUEBgQFBm0ABgAEBgBrAAAAbgABAAMCAQNgAAIEBAJUAAICBFgABAIETFlAC1NSGhskJx0aBwUaKwEUDgEUHgEdARQGIiY9ATQ+ATQuAT0BNDYyFhUFBwYXFjMyNzYnJiMiEzQ+Aj8BNjU3BiInFxQfAxYmFiMUDgIPAgYmBjUGHQE+AjU0MhUUHgEXNTQvAiYvAS4BAjBgYmJgrNisYGJiYK7Urv4eEgQIXHyEWA4eYGp4kAgcDBkdXAJk9GQEWi0TEREMHgwCCgYIDA8PAiJaCHRENEJ6BlwrEg0FDAcEAm4saF48XGYudiJOTiJ2LmZcPF5oLHYgTk4gBg4IBjQyChQ2/koSHiQOGBxcHjI2NjIgWisTFRUCMAoSEg4KDxAQAiIBWiBCBCYwIh4eIjAmBEIeXCkTDggUDBYAAAAAAgAA/5wDhAMgABcAHgDOQA4dAQcFHgEGBxgBAgYDR0uwCVBYQC8ABQQHBAVlAAIGAwMCZQgBAAAEBQAEXgAHAAYCBwZeAAMBAQNSAAMDAVkAAQMBTRtLsA1QWEAwAAUEBwQFB20AAgYDAwJlCAEAAAQFAAReAAcABgIHBl4AAwEBA1IAAwMBWQABAwFNG0AxAAUEBwQFB20AAgYDBgIDbQgBAAAEBQAEXgAHAAYCBwZeAAMBAQNSAAMDAVkAAQMBTVlZQBcBABwbGhkTEhEQDw4NDAkGABcBFgkFFCsBMhYVERQGIyEiJj0BMxUhESEVIzU0NjMTNSE1ITUXAyAqOjoq/j4oOmIBwv4+YjooZP4+AcLIAyA6Kv1EKDw8KGRkAryWlio6/WJ4lnjCAAAAAAIAAP+cA4QDIAAXAB4AyEAKHgEHAxkBAAYCR0uwCVBYQDAAAwQHBANlAAAGBQUAZQACAAQDAgReAAcABgAHBl4IAQUBAQVSCAEFBQFZAAEFAU0bS7ANUFhAMQADBAcEAwdtAAAGBQUAZQACAAQDAgReAAcABgAHBl4IAQUBAQVSCAEFBQFZAAEFAU0bQDIAAwQHBAMHbQAABgUGAAVtAAIABAMCBF4ABwAGAAcGXggBBQEBBVIIAQUFAVkAAQUBTVlZQBIAAB0cGxoAFwAXERM1MxEJBRkrITUzFRQGIyEiJjURNDYzITIWHQEjNSERAQc1ITUhNQH2Yjoq/nAoPDwoAZAqOmL+bgMgxv4+AcJkZCg8PCgCvCo6OiqWlv1EAUbEeJZ4AAAABP///7EELwMLAAgADwAfAC8AVUBSHRQCAQMPAQABDg0MCQQCABwVAgQCBEcAAgAEAAIEbQAGBwEDAQYDYAABAAACAQBgAAQFBQRUAAQEBVgABQQFTBEQLismIxkXEB8RHxMTEggFFysBFA4BJjQ2HgEBFSE1NxcBJSEiBgcRFBY3ITI2JxE0JhcRFAYHISImNxE0NjchMhYBZT5aPj5aPgI8/O6yWgEdAR78gwcKAQwGA30HDAEKUTQl/IMkNgE0JQN9JTQCES0+AkJWQgQ6/vr6a7NZAR2hCgj9WgcMAQoIAqYIChL9WiU0ATYkAqYlNAE2AAL//P9+A9gDSgANAB8ACLUfFAgBAi0rNzYeAgcGBwY3NDc+AQEWAAcGBwYnJicmJyY3Njc2AHYmXlIMJFaOVAQGNBgDbBr+pHYmVggIEh4gIhAIQCh2AcSqIgpQXiRUEgwaBAY8qgKoGv5EdCZCBg4iHiAQBgpUJnQBVgABAAD/rAOsAuAAFwBDQEATCAICBAcBAQICRwUBBAMCAwQCbQYBAAADBAADYAACAQECVAACAgFYAAECAUwBABUUEhEPDgsJBgQAFwEXBwUUKwEyFhAGIyInNxYzMjYQJiIGBzMHJzM+AQIUqu7uqo5uRlRifrS0+rQCjri4fALwAuDw/qzwWEo8tAEAtK58zMym6gAAAQAA/8QDrAL4ABcAQ0BAEAUCBAERAQUEAkcCAQEDBAMBBG0GAQAAAwEAA2AABAUFBFQABAQFWAAFBAVMAQAUEg8NCgkHBgQDABcBFwcFFCsBMhYXMwcnMy4BIgYUFjMyNxcGIyImEDYBmKjuBHq4uJAEtPq0tH5oTkZujqjw8AL46KbOznystP60PExY8AFU8AAAAAL//v/EAzYC+AAOAB0AJUAiHRwXEQoEAQcAAQFHCQEBRRYBAEQAAQABbwAAAGYcEgIFFis/ARElNyYSNzY3FwYHDgEBBQcWAgcGByc2Nz4BJwe6dP7sWHQEdmSMBGRIWAQBogEUWHQEdmCQAmJIWARWcox0/twQVnoBUHhkEGYQSFj6AfoQVnr+sHhiFGgQSFj6XHQAAAAACgAA/8gDLQL1ABQAKQA5AEIASwBUAF0AZgBvAHgAk0CQFQEAAAMHAANgAAcACAUHCGAJAQUACgYFCmATAQsUAQwECwxgAAYXAQQNBgRgAA0ADhINDmAAEQASDxESYAAPABACDxBgFgECAQECVBYBAgIBWAABAgFMLCoWFQEAd3Zzcm5tamllZGFgXFtYV1NST05KSUZFQUA9PDY0MjEqOSw5IB8VKRYpCwoAFAEUGAUUKwEyFxYXFhQHBgcGIicmJyY0NzY3NhMyNzY3NjQnJicmIgcGBwYUFxYXFhMjIi8BJj4CHwEzMhYOAQM0NjIWFAYiJhc0NjIWFAYiJhc0NjIWFAYiJgc0NjIWFAYiJgc0NjIWFAYiJic0NjIWFAYiJic0NjIWFAYiJgGWbl9cNjg4Nlxf3V5cNjc3Nlxeb1ZKSCorKypISqxKSCorKypISs5/FQyPDgQaIw6CbBYXAhelDxIPDhQOpw4SDw4TDkkPEg8OFA5CDhQODxIPrw4UDg8SD6IOEg8OFA1LDhIPDhQNAvU4NVxf3V5cNjg4Nlxe3V9cNTj9LSwqSEqsSkcqKysqR0qsSkgqLAEMD5wPIhgCDo4bJBsBHwoODhQODzgKDg4UDg+iCQ8PEg8OngoODhMODj8JDw8SDw5LCQ8PEg8OuQkPDxIPDgAAAAL//f+xA18DCwAMABkAK0AoAAMEAQABAwBgAAECAgFUAAEBAlgAAgECTAEAFxYREAcGAAwBDAUFFCsBIg4CHgEyPgEuAgEUDgEiLgI+ATIeAQGtU4xQAlSIqoZWBE6OAVtyxujIbgZ6vPS6fgKOUoykjFJSjKSMUv7QdcR0dMTqxHR0xAAAAAAD//3/sQNfAwsACAAVACIAPEA5AAECAAIBAG0AAAMCAANrAAUGAQIBBQJgAAMEBANUAAMDBFgABAMETAoJIB8aGRAPCRUKFRMSBwUWKwEUBiIuATYyFiciDgIeATI+AS4CARQOASIuAj4BMh4BAjtSeFICVnRWkFOMUAJUiKqGVgROjgFbcsboyG4Gerz0un4BXjtUVHZUVPVSjKSMUlKMpIxS/tB1xHR0xOrEdHTEAAH//f+xA18DCwAMABFADgABAAFvAAAAZhUTAgUWKwEUDgEiLgI+ATIeAQNZcsboyG4Gerz0un4BXnXEdHTE6sR0dMQAAgAA//kDoAMLAC0AQgBOQEs7AQQGJQEFBAJHAAcBAgEHAm0ABgIEAgYEbQAEBQIEBWsABQMCBQNrAAEAAgYBAmAAAwAAA1QAAwMAWAAAAwBMFBcVJzU5NTMIBRwrARUUBiMhIiY1ETQ2NyEyFx4BDwEGIycmIyEiBgcRFBYXITI2PQE0PwE2MzIXFhMBBiIvASY0PwE2Mh8BATYyHwEWFAMSXkP+MENeXkMB0CMeCQMHGwYHBQ0M/jAlNAE2JAHQJTQFJAYHAwQLgf45DSQO8A4OPQ4kDpMBaQ0kDj4NAUuxQ15eQwHQQl4BDgQTBhwFAQM0Jf4wJTQBNiSNCAUjBgIEAQX+Og4O8A0kDj4NDZMBaQ0NPQ4kAAIAAP/5AxMDCwAPAB8AK0AoAAMEAQABAwBgAAECAgFUAAEBAlgAAgECTAIAHhsWEwoHAA8CDwUFFCsBISIGBxEUFhchMjY1ETQmFxEUBiMhIiY1ETQ2NyEyFgJx/jAlNAE2JAHQJTQ0fF5D/jBDXl5DAdBCYALDNCX+MCU0ATYkAdAlNFn+MENeXkMB0EJeAWAAAAABAAD/fAK8A1AAJQAWQBMQAQBFAAABAG8AAQFmGRclAgUVKwEWFREUBiMiNRE0JyUmBwYHBRYVERQHBiMiJyYkJyY1AzQ3PgEXAqoSGBAuDP5sICQsDAGYEhIGCg4GCP58EhoGDhyUKgJSCBT9zg4WJAIKDAbYChQUGOQIFP3aFgYEBAbyChIQAgwcGC4+FgAD////sQPoAsMAGQA5AEkAQEA9GxIBAwMCEwACAQACRwADAgACAwBtAAABAgABawAFAAIDBQJeAAEEBAFUAAEBBFgABAEETDU9LRkqKQYFGislEQYHBgcOAicjIi4BJyYnJicRFBY3ITI2EzUvASYGJyEiBgcUFxYXHgQ3MzI+Azc2Nz4BNxEUBgchIiY3ETQ2MyEyFgOhEhWVWRwkPBsCGj4iHViWFRIMBgM2BwoBAgMDBAb8ygcKAVNrdAQgEiAYDAILGh4UHgV0bB40RzQl/MokNgE0JQM2JTQLAawUEHNKGBoeAhoeFkpzEBT+VAcMAQoCUg4OBQUCAwwGXkFUXAMcDhQMAQoWDB4CXFQYUjX9oSU0ATYkAl8lNDQAAAAC////sQPpAsMAGQA4AC1AKgkAAgIDAUcAAwIDbwACAQJvAAEAAAFUAAEBAFgAAAEATDc0JiQ6MwQFFisBERQGByEiJjcRFhcWFx4CNzMyPgE3Njc2NxQGBwYPAQ4CJyMiJi8BLgEvASYnLgEnNDYzITIWA+g0JfzKJDYBGR/KTCAmRBsCHEIoH1+3IBg2KdI0NQwiHg0CDB4RHg0iBpNgEiM8AS4rAzYkNgHG/kUlNAE2JAG7GxaJNxgaHAEaHBdEfBa/LFAdkiMnCRIMAQoKEggcA2VCDhdSJCs6NAAAAAH///+0AzkC7gAlAA9ADBsBAEQAAABmKQEFFSsBNi8BLgE2Nz4CMh8BFh8BFgIABC8BJi8BJj8BPgE3PgEeARcWAc2iLAgeFg4qFCIkGBEYBxMVMGz+1P7eMBcVBBIOAQIBHBgqODQSHiwBIqIsCB4kSDQYHgINEgUUFjD+3P7WbjAWFAUYEwweEiIUIhoWDh4sAAAHAAD/nAOEAygAAwAHACAAJAAoACwAMAATQBAvLSspKCYjIRwRBwUDAQctKyUVJzU3FSc1ARYVERQHBQYiBiImIyclJjURNDc2FwUlNgERJREhEQURARUHNRMVBzUBVMjIyALiFiD+cggEBgQGAgr+ciAWFhgBfgF+GP44/sAC5P7AAQTIyMjuRFBEgERQRAEKDB79gCIMoAICAgKgDCICgB4MEAqamgr83AIwgP3QAjCA/dABOkRQRAEgRFBEAAAG////agQvA1IAEQAyADsARABWAF8AwbZPDgIDAgFHS7AkUFhARgALCQgJCwhtEAEIAgkIAmsPAQIDCQIDawcBBQABAAUBbQwKAgEGAAEGawAGBAAGBGsABARuDgEDDQEABQMAYBEBCQkMCUkbQEcRAQkLCW8ACwgLbxABCAIIbw8BAgMCbwcBBQABAAUBbQwKAgEGAAEGawAGBAAGBGsABARuDgEDAAADVA4BAwMAWA0BAAMATFlAHl5dWllWVFJQS0pJR0NCPz46ORkVFBk3IxMhEBIFHSsBBgcjIiY3NDMyHgE3MjcGFRQBFAYjISImJzQ+BTMyHgI+AT8BNjcyHgQXARQGIiY0NjIWARQGLgE+AhYFFAYnIyYnNjU0JxYzMj4BFzInFAYiJjQ2MhYBS1o6Sy1AAUUEKkIhJiUDAoNSQ/4YRFABBAwQICY6IQYkLkhQRhkpEAgiOCYgEA4B/cZUdlRUdlQBiX6wgAJ8tHoBQz4uSzlaLQMlJSFEKARFR1R2VFR2VAFeA0QsLMUWGgENFRBO/ltCTk5CHjhCODQmFhgcGgIWEBoKAhYmNDhCHAKPO1RUdlRU/u9ZfgJ6tngGhNMrLgFEA0FOEBUNGBgBjztUVHZUVAAAAAIAAP9pAjsDQwAlAC4AP0A8JgEICQFHBgMCAAECAQACbQQBAgJuAAkACAcJCGAABwEBB1QABwcBVgUBAQcBSi0sFDUTExMTExMTCgUdKwEVFAYiJic1IxEUBi4BNxEjERQGLgE3ESMVFAYiJic1NDYzITIWJxQOASY+AR4BAjseLh4BIyYyJgEkJjImASQeLh4BPi0BZS0+oEpmTAREbkIByegWICAWxP4DGSYCIhsBA/79GSYCIhsB/cQWICAW6C0+Ps00SAJMZE4GQgAAAAACAAD/aQLKA0MAMQA6AE5ASzIBCAkfCAIAARwBAgADRwYBAAECAQACbQQBAgMBAgNrAAMDbgAJAAgHCQhgAAcBAQdUAAcHAVYFAQEHAUo5OBY2IhYjMyYSIgoFHSsBFAYHIi8BIxUXFhUUBisBFRQGJyMiJjc1IyImJzQ/ATUjBwYjIiYnND8BNjsBMh8BFgMUDgEuATYeAQLKHhcdEH8ZigUUEGskGlkaJgFrDxQBBYoZfxAcFx4BCY8pOdY6KY4J6EhqRgROYlABBRceARi+SeYICg4WmBkmASQamBYOCgjmSb4YIBYQDdc7O9cNAa40SAJMZE4GQgAAAAACAAD/cgKnAvwAHQAmAEdARBABAgEEAUceAQMBRgUBAwcGBwMGbQAEBgEGBAFtAAEABgEAawIBAABuAAcDBgdUAAcHBlgABgcGTBMVEhIXExMUCAUcKwEHERQGLgE3NSMVFAYuAScRJyY0NjIfATM3NjIWFCcUBi4CPgEWApejJDQmASQkNCQBow8eLg+AzX8QLCDFSGpGBE5iUAIgo/40GSYCIhvX1xkmAiIbAcyjECwgEH9/ECAsTDRKAkZsRAZQAAAAAQAA/8oDoQNAAB8AHUAaEg8KBAMFAAIBRwACAAJvAQEAAGYdFBcDBRcrARQPARMVFA4BLwEHBiImNTQ3EycmNTQ3JTc2Mh8BBRYDoQ/KMAwVDPv6DBYMATDLDh8BGH4LIAx9ARggAekMD8X+6QwLEAEHhIQHEgoECAEXxQ8MFQUo/hcX/igFAAP//f+xA1kDCwAMAb4B+AJ3S7AJUFhBPAC9ALsAuACfAJYAiAAGAAMAAACPAAEAAgADANoA0wBtAFkAUQBCAD4AMwAgABkACgAHAAIBngGYAZYBjAGLAXoBdQFlAWMBAwDhAOAADAAGAAcBUwFNASgAAwAIAAYB9QHcAdIBzAHBAb8BOAEzAAgAAQAIAAYARxtLsApQWEFDALsAuACfAIgABAAFAAAAvQABAAMABQCPAAEAAgADANoA0wBtAFkAUQBCAD4AMwAgABkACgAHAAIBngGYAZYBjAGLAXoBdQFlAWMBAwDhAOAADAAGAAcBUwFNASgAAwAIAAYB9QHcAdIBzAHBAb8BOAEzAAgAAQAIAAcARwCWAAEABQABAEYbQTwAvQC7ALgAnwCWAIgABgADAAAAjwABAAIAAwDaANMAbQBZAFEAQgA+ADMAIAAZAAoABwACAZ4BmAGWAYwBiwF6AXUBZQFjAQMA4QDgAAwABgAHAVMBTQEoAAMACAAGAfUB3AHSAcwBwQG/ATgBMwAIAAEACAAGAEdZWUuwCVBYQDUAAgMHAwIHbQAHBgMHBmsABggDBghrAAgBAwgBawABAW4JAQADAwBUCQEAAANYBQQCAwADTBtLsApQWEA6BAEDBQIFA2UAAgcFAgdrAAcGBQcGawAGCAUGCGsACAEFCAFrAAEBbgkBAAUFAFQJAQAABVYABQAFShtANQACAwcDAgdtAAcGAwcGawAGCAMGCGsACAEDCAFrAAEBbgkBAAMDAFQJAQAAA1gFBAIDAANMWVlBGQABAAAB2QHXAboBuAFXAVYAxwDFALUAtACxAK4AeQB2AAcABgAAAAwAAQAMAAoABQAUKwEyHgEUDgEiLgI+AQEOAQcyPgE1PgE3NhcmNj8BNj8BBiY1FAc0JgY1LgQvASY0LwEHBhQqARQiBiIHNicmIzYmJzMuAicuAQcGFB8BFgYeAQcGDwEGFhcWFAYiDwEGJicmJyYHJicmBzImBz4BIzY/ATYnFj8BNjc2MhYzFjQnMicmJyYHBhciDwEGLwEmJyIHNiYjNicmIg8BBh4BMhcWByIGIgYWBy4BJxYnIyIGIicmNzQXJwYHMjY/ATYXNxcmBwYHFgcnLgEnIgcGBx4CFDcWBzIXFhcWBycmBhYzIg8BBh8BBhY3Bh8DHgIXBhYHIgY1HgIUFjc2Jy4CNTMyHwEGHgIzHgEHMh4EHwMWMj8BNhYXFjciHwEeARUeARc2NQYWMzY1Bi8BJjQmNhcyNi4CJwYmJxQGFSM2ND8BNi8BJgciBw4DJicuATQ/ATYnNj8BNjsBMjQ2JiMWNhcWNycmNxY3HgIfARY2NxYXHgE+ASY1JzUuATY3NDY/ATYnMjcnJiI3Nic+ATMWNzYnPgE3FjYmPgEVNzYjFjc2JzYmJzMyNTYnJgM2NyYiLwE2Ji8BJi8BJg8BIg8BFSYnIi4BDgEPASY2JgYPAQY2BhUOARUuATceARcWBwYHBhcUBhYBrXTGcnLG6MhuBnq8ARMCCAMBAgQDERUTCgEMAggGAwEHBgQECgUGBAEIAQIBAwMEBAQEBgEGAggJBQQGAgQDAQgMAQUcBAMCAgEIAQ4BAgcJAwQEAQQCAwEHCgIEBQ0DAxQOEwQIBgECAQIFCQIBEwkGBAIFBgoDCAQHBQMCBgkEBgEFCQQFAwMCBQQBDgcLDwQQAwMBCAQIAQgDAQgEAwICAwQCBBIFAwwMAQMDAgwZGwMGBQUTBQMLBA0LAQQCBgQIBAkEUTIEBQIGBQMBGAoBAgcFBAMEBAQBAgEBAQIKBwcSBAcJBAMIBAIOAQECAg4CBAICDwgDBAMCAwUBBAoKAQQIBAUMBwIDCAMJBxYGBgUICBAEFAoBAgQCBgMOAwQBCgUIEQoCAgICAQUCBAEKAgMMAwIIAQIIAwEDAgcLBAECAggUAwgKAQIBBAIDBQIBAwIBAwEEGAMJAwEBAQMNAg4EAgMBBAMFAgYIBAICAQgEBAcIBQcMBAQCAgIGAQUEAwIDBQcEAwISAQQCAgUOCQICCggFCQIGBgcFCQwKaXNQAQwBDQEEAxUBAwUCAwICAQUMCAMGBgYGAQEECAQKAQcGAgoCBAEMAQECAgQLDwECCQoBAwt0xOrEdHTE6sR0/t0BCAIGBgEECAMFCwEMAQMCAgwBCgcCAwQCBAECBgwFBgMDAgQBAQMDBAIEAQMDAgIIBAIGBAEDBAEEBAYHAwgHCgcEBQYFDAMBAgQCAQMMCQ4DBAUHCAUDEQIDDggFDAMBAwkJBgQDBgEOBAoEAQIFAgIGCgQHBwcBCQUIBwgDAgcDAgQCBgIEBQoDAw4CBQICBQQHAgEKCA8CAwMHAwIOAwIDBAYEBgQEAQEtTwQBCAQDBAYPCgIGBAUEBQ4JFAsCAQYaAgEXBQQGAwUUAwMQBQIBBAgFCAQBCxgNBQwCAgQEDAgOBA4BCgsUBwgBBQMNAgECARIDCgQECQUGAgMKAwIDBQwCEAgSAwMEBAYCBAoHDgEFAgQBBAICEAUPBQIFAwILAggEBAICBBgOCQ4FCQEEBgECAwIBBAMGBwYFAg8KAQQBAgMBAgMIBRcEAggIAwUOAgoKBQECAwQLCQUCAgICBgIKBgUFBAQEAwEECgQGAQcCAQcGBQQCAwEFBAL+DRVVAgIFBAYCDwEBAgECAQEDAgoDBgICBQYHAw4GAgEFBAIIAQIIAgICAgUcCBEJDgkMAgQQBwAABAAA//kBrQLDAAgAGAAhADEAQkA/EgoJAwMCAAEBAAJHAAcABAUHBGAABQACAwUCYAADAAABAwBgAAEGBgFUAAEBBlgABgEGTDU0MTQmJRMSCAUcKyU0JiIOAR4BNjcRNCYjISIGFREUFjMhMjYDNCsBIhQ7ATI3ERQGIyEiJjURNDYzITIWAQMaJhgCHCIecgoI/uIHCgoHAR4HDGwJWQkJWQmhLBz+4h0qKh0BHh0qQBMaGiYYAhxrAYgICgoI/ngICgoB4QkSEv3EHSoqHQI8HSoqAAAAA/////kChAMLAAgAGAAoAF5ADBIRCgMCAQABAwACR0uwDFBYQB4AAwAAA2QABAABAgQBYAACAAACVAACAgBYAAACAEwbQB0AAwADcAAEAAECBAFgAAIAAAJUAAICAFgAAAIATFm3NTYmKRIFBRkrJTQuAQ4BFj4BNxE0JiMhIgYHERQWMyEyNhMRFAYjISImNxE0NjchMhYBZRQgEgIWHBjUCgf+LwcKAQwGAdEHCkg0Jf4vJDYBNCUB0SQ2QA8UAhgaGAQQawIXCAoKCP3pCAoKAh/9oSU0NCUCXyU0ATYAAAAABP////kELwLDAA8AHwAqADIAVUBSGRECAgMBRwABAAMCAQNeAAIIAQAEAgBgCQEEAAcGBAdgCgEGBQUGVAoBBgYFWAAFBgVMLCshIAEAMC0rMiwxJyQgKiEqHRwVEwkGAA8BDgsFFCs3IiY1ETQ2MyEyFhcRFAYjAREUFjchMjY1ETQmJyEiBgEzFRQGByEiJjc1BTI0KwEiFDPoJTQ0JQJfJTQBNiT9jwwGAl8ICgoI/aEHCgL/WTQl/IMkNgECRAkJWQkJiDQlAYklNDQl/nclNAHi/ncHDAEKCAGJBwoBDP30NhYeASAVNjYSEgAAAv///7EELwNSAA8ALwBbQAsJAQIBACABAwICR0uwJFBYQBkAAwIDcAABBAECAwECYAAAAAVYAAUFDABJG0AeAAMCA3AABQAAAQUAXgABAgIBVAABAQJYBAECAQJMWUAJNSY2JiYUBgUaKwERNCYnISIGBxEUFjMhMjYTERQGByEUHgEXFAYjISImJzQ+ATUhIiY3ETQ2MyEyFgPoCgj8gwcKAQwGA30HDEY0Jf7REhABFA/+4g8UARIS/tAkNgE0JQN9JTQBKAHRBwoBDAb+LwcKCgHY/aElNAEULiIHDhYWDggiLBU2JAJfJTQ0AAAAAgAA/7EDWgMLAAgAagBFQEJlWUxBBAAEOwoCAQA0KBsQBAMBA0cABQQFbwYBBAAEbwAAAQBvAAEDAW8AAwIDbwACAmZcW1NRSUgrKiIgExIHBRYrATQmIg4BFjI2JRUUBg8BBgcWFxYUBw4BJyIvAQYHBgcGKwEiJjUnJicHBiInJicmNDc+ATcmLwEuASc1NDY/ATY3JicmNDc+ATMyHwE2NzY3NjsBMhYfARYXNzYyFxYXFhQHDgEHFh8BHgECO1J4UgJWdFYBHAgHaAoLEygGBQ9QDQcHTRkaCQcEEHwIDBAbF08GEAZGFgQFCCgKDwhmBwgBCgVoCA4XJQYFD1ANBwhNGBoJCAMRfAcMAQ8cF08FDwdIFAQECSgKDwhmBwoBXjtUVHZUVHh8BwwBEB4VGzIGDgYVUAEFPA0ITBwQCgdnCQw8BQZAHgUOBgwyDxwbDwEMB3wHDAEQGRogLQcMBxRQBTwNCEwcEAoHZwkLOwUFQxwFDgYMMg8cGhABDAAAAAYAAP9yBC8DSQAIABIAGwB6ALYA8QCcQJnu2QIEDmpdAgUI0LxwAwAFvqygdVJMRSMdCQEAs55AAwIBOi0CBgKVgAILAwdH59sCDkWCAQtECgEICQUJCAVtAAYCBwIGB20ADgAECQ4EYAAJCAAJVAAFDQEAAQUAYAACBgECVAwBAQAHAwEHYAADCwsDVAADAwtYAAsDC0zl48fGqqiLim1sZGJaWTQyKyoTFBQUExIPBRorATQmIgYUFjI2BTQmDgEXFBYyNgM0JiIGHgEyNgcVFAYPAQYHFhcWFAcOASIvAQYHBgcGKwEiJjUnJicHBiInJjU0Nz4BNyYvAS4BPQE0Nj8BNjcmJyY0Nz4BMzIfATY3Njc2OwEyFh8BFhc3NjIXFhUUDwEGBxYfAR4BARUUBwYHFhUUBwYjIi8BBiInDgEHIicmNTQ3JicmPQE0NzY3JjU0PwE2MzIWFzcXNj8BMhcWFRQHFhcWERUUBwYHFhUUBwYjIiYnBiInDgEiJyY1NDcmJyY9ATQ3NjcmNTQ/ATYzMhYXNxc2PwEyFxYVFAcWFxYB9FR2VFR2VAGtLDgsASo6LAEsOCwBKjos2AgEVwYMEx8EBAxEEAVAFRYGBwQNaAYKDRMXQgQNBlAEBSQIDQdVBQgIBVYHCxMfBAQMRAoGBkATGAYHAw1oBgoBDRMXQQUNBVEEGBEIDQZVBgYBZlMGChwCRAEFFR0LDAsHLAMBRAMdCgdTUwcKHQM0EAEEKggRERwXBAJDAhwJB1NTBgocAkQBBSoICwwLBywERAMdCgdTUwcKHQM0EAEEKggRERwXBAJDAhwJB1MBXjtUVHZUVOMdLAIoHx0qKgJZHSoqOyoqzWcGCgEOExcbJQYMBBFCBDILBjwbDQgGVQYMMgQESw8FBQgsDBgWDQEIB2gFCgEOExcbJQYMBRBCBDIKCDwaDQgGVQYLMQQESw8FBR4VDRsTDAII/s9OCQgPDj8OAgIoGyUBAQs0ASgCAg4/Dg8ICU4JCRANPw4CAh4JNAwBASgXAScCAg4/DRAJAjNOCQkPDj8OAgInNAwBAQw0JwICDj8ODwkJTgkIEA0/DgICHgk0CwEBJxcBJwICDj8NEAgAAAEAAAAAAlgB5gAVABlAFg8BAAEBRwIBAQABbwAAAGYUFxQDBRcrARQHAQYiJwEmND8BNjIfATc2Mh8BFgJYBv78BRAE/vwGBhwFDgbb3AUQBBwGAbcHBf77BQUBBQUOBhwGBtvbBgYcBQAAAAMAAP92A6ADCwAIABQALgAzQDAmAQQDKCcSAwIEAAEBAANHAAMEA28ABAIEbwACAAJvAAABAG8AAQFmHCMtGBIFBRkrNzQmDgIeATYlAQYiLwEmNDcBHgElFAcOASciJjQ2NzIWFxYUDwEVFzY/ATYyFtYUHhQCGBoYAWb+gxU6FjsVFQF8FlQBmQ0bgk9okpJoIEYZCQmjbAIqSyEPCh0OFgISIBIEGvb+gxQUPRQ7FgF8N1TdFiVLXgGS0JACFBAGEgdefTwCGS0UCgAAAAAJAAD/sQNZAsQAAwATABcAGwAfAC8APwBDAEcAn0CcKwELBjsBDQQCRxoRFQMHEAEGCwcGXhcBCgALDAoLYBkPFAMFDgEEDQUEXhgBDAANAgwNYBMBAgEDAlQWCRIDAQgBAAMBAF4TAQICA1gAAwIDTEREQEAxMCEgHBwYGBQUBQQAAERHREdGRUBDQENCQTk2MD8xPykmIC8hLxwfHB8eHRgbGBsaGRQXFBcWFQ0KBBMFEwADAAMRGwUVKzcVIzUlMhYdARQGKwEiJj0BNDY/ARUhNRMVIzUBFSE1AzIWBxUUBgcjIiYnNTQ2FwEyFgcVFAYHIyImJzU0NhcFFSM1ExUhNcTEAYkOFhYOjw4WFg7o/h59fQNZ/mV9DxYBFBCODxQBFg4B9A4WARQPjw8UARYOAUF9ff4eQEdHSBYOjw4WFg6PDxQB1kdHAR5ISP3ER0cCgxQQjg8UARYOjg8WAf7iFA+PDxQBFg6PDhYBR0dHAR5ISAAAAgAA//kCgwMLAAcAHwAqQCcFAwIAAQIBAAJtAAICbgAEAQEEVAAEBAFYAAEEAUwjEyU2ExAGBRorEyE1NCYOARcFERQGByEiJicRNDYXMzU0NjIWBxUzMhazAR1UdlQBAdAgFv3pFx4BIBYRlMyWAhIXHgGlbDtUAlA9of6+Fh4BIBUBQhYgAWxmlJRmbB4ABAAA/5IDhAMqACcALQA6AEAATkBLPgwBAwAGAUcABgQABAYAbQAAAG4AAggBBQECBWADAQEEBAFUAwEBAQRWCQcCBAEESjs7Ly47QDtANTQuOi86LCseHBsaGRcWCgUVKyUVHgEVFAYiJjU0Njc1NCYnLgM1NDY7ATYgFzMyFhUUDgIHDgE3PgE3IwYDIg4BFB4BMj4BNC4BBR4BFyYnAf5GXIK2hFxIQlA4PlgoFg6sMAGGMKoOFihYPjhOQopQXAh+BvY+XCQkXHxcJCRc/kgIXFAwBoZCCDAgJDY2JCAwCEIyRDYkMl56TA4UXFwUDkx6XjIkNEbKOHRangEEHiIaIh4eIhoiHmZadDhongAC//3/agPrA1IAJwBQAIFADiQWBgMBAkxCNAMEAwJHS7AkUFhAIwABAgMCAQNtBwEDBAIDBGsABAAFBAVcAAICAFgGAQAADAJJG0ApAAECAwIBA20HAQMEAgMEawYBAAACAQACYAAEBQUEVAAEBAVYAAUEBUxZQBcpKAEAR0UxLyhQKVAUEgwKACcBJwgFFCsBIgcGBwYHFBYfATMyNTY3Njc2MzIWFwcGFh8BFj4BLwEuAQ8BJicmASIVBgcGBwYjIicmJzc2Ji8BJg4BHwEeAT8BFhcWMzI3Njc2NzQmLwEB7oNxbUNFBQUEBFQTBTUzU1djT440OgkCDPcLFAoEOgISCUFEWlwBMxMFNTNTVmNQSEU1OwgCC/gLFAoEOgISCkBEWl1mgnFuQkUFBQQEA1JAPmtugQgJAgESYlNRLzE+ODkJEwMyAwkWEOMICwY8RiYo/gQSYlNRLzEgHjg5CRMDMgMJFhDjCAsGPEYmKEA+a26CCAgCAQAAAAP///9qA+gDUgAtAF8AiwCgtSQBAwABR0uwJFBYQDMJAQMAAgADAm0AAQIHAgEHbQoBBwQCBwRrAAQGAgQGawAGAAUGBVwAAgIAWAgBAAAMAkkbQDkJAQMAAgADAm0AAQIHAgEHbQoBBwQCBwRrAAQGAgQGawgBAAACAQACYAAGBQUGVAAGBgVYAAUGBUxZQB9gYC8uAQBgi2CKgX1va0xLLl8vXxsWDQsALQErCwUUKwEiBwYHBgcGBxUUFjsBMjY3PgE3Njc2MzkCMh8BFh8BFjY/ATYmJyYvASYjMQUiDwEGFhcWHwEWFTkBFAYHBgcGBzkCDgEfARQWMjc2NzY3NjU0JyYnJicmJzEmIyYBMSMOARceARcWFxYzOQEyNzY/AT4BLwEmBwYPAQYjOQEiJyYnIy4BJy4BIwHwgnFtRRoUEQsGBWUEBgEWcU8aJTEuKCIOBAQGBAgBNAIFBCYbDSYsAUcIAzICAQMtHAseIB4OCg0PAwECMgUJBFktCgUVGBgsERQaDwEBBPzUAwQGARmhdCozNS86OwURFwUCAzIFCBUVCBsaXlRQNQEUHgkBBgQDUj48aCcuKDQDBQcFBFSGIw0KCwcDAQECAQMEWQUJAQwFAgdyBlcDCAMtOBZJTjlrLRYLEA8DCANXAQYDT28ZE0VLUEtKPhgWHA0BAv4sAQgFfMIwEQsKDgEECAIKBFcIAgYDAgMsKkodPyIEBgAABf/6/2oD6QNYAB8APQBaAHgAmABHQERqAQUDkwEEAgJHKwEARQAAAQBvAAEDAW8AAwUDbwACBQQFAgRtAAUCBAVUAAUFBFgABAUETJGPf311c2dlS0kxLwYFFCs3MSMuAScmNjc+ARcyFRceAQcOAQcGFhcWDwEGJiciNRMxNTY3Njc+ARcWFQ8BDgEnIwYHDgEHBiIvAS4BNyUxMxYXFhceARcWBgcnIiYnJicmJyYnJj8BPgEXEzEwMQYHBgcOAQcGJi8CJjY3PgE3Njc2MxcyFhUBMTAxBiMiJy4BJyY0PwE2FhcWFxYXFjcyHwEWBgcGIy4BCxMGDhEgAgkEAlAEAgIHCwMIDBMDB1AECQMBeBUZHRZDmE4KAR8BCAQoGg4zXygDCANPBAEDAk4BGBoQHjhMEAIGBWYEBgEBCwsGMFkHAh8BCQX2BgkMCiFpQwQKAgEeAQMEECENSxoDCGIFBv5KHh4iGU2NOgQEUgQJAxQMFgxeagkDHQIEBQECkBg8HUuYRwQDAgE7AggEECkUMmcwCAU4AwIEAgI+ARMSFAsmHwkCCwJeBAQBAgIIKyECAjoCCgRCDhIMGjSGTAUHAQEFBAcfGwleOAQJXAQFAv3oHhsgF0ZxJgICBAJeBAgCChsNSWcIAQYF/nIDBAk/NQMJBDsCAQMQBw4GLwYIXAQIAgEAAAL///9bA+oDUgAfAEEASUAKBAECAAFHMQEBREuwJFBYQBMAAgABAAIBbQABAW4DAQAADABJG0APAwEAAgBvAAIBAm8AAQFmWUANAQAhIBQTAB8BHwQFFCsBIgcGBzE2NzYXFhcWFxYGBwYXHgE3PgE3NiYnLgEnJgEiBwYHBgcGFhcWFxYXFjc2NzEGBwYnJicmJyY2NzYmJyYB8ldRVERWbGpnak9CISEGJQ4aEDMRAwoCIwElJpBeW/4FGA8EBAYBJAIkJkhbe3d5fWFWbGpna09CISAFJQgGDhIDUh0eOUUVFB4gT0JWU7NRKRsQAREDDwZaw1ldkCYl/u4QBAYIBlrDWV1IWyQiGBlRRRUUHiBPQlZTs1EVIQ4SAAAAAAwAAP9qA+gDUgAPACEANQBJAFwAbQB+AJAApAC4AMoA2gD/QCgMAQIBHAQCAAJVTQIEAHtzamIEAwaLAQgFxAELB9e8AgkLzwEKCQhHS7AkUFhARw0BAgEAAQIAbRABCAUHBQgHbQAHCwUHC2sACQsKCwkKbQ4BBAADBQQDYA8BBgAFCAYFYBEBCwAKCwpcAAAAAVgMAQEBDABJG0BODQECAQABAgBtEAEIBQcFCAdtAAcLBQcLawAJCwoLCQptDAEBAAAEAQBgDgEEAAMFBANgDwEGAAUIBgVgEQELCQoLVBEBCwsKWAAKCwpMWUAyy8umpW5uXV0jIgAAy9rL2dPRwsCluKa4iYdufm59d3VdbV1sZmQiNSM1AA8ADiYSBRUrASIGHQEUFjsBMjY9ATQmIxcmDwEGFh8BFRY2PwE2Ji8BJgUiDwEOAR8BMDEeAT8BPgEvATUmBSIPATAxDgEfAR4BPwEzPgEvASYFIg8BBhYfARY2PwEwMTYmLwEmBTEiBh0BFBY7ATI2PQE0JiMFMSIGHQEUFjsBMjY9ATQmIwUiDwEjBhYfARY2PwE2Ji8BJgUiDwEjDgEfAR4BPwEwMT4BLwEmBSIPAQ4BHwEVHgE/AT4BLwEwMSYFIg8BBhYfARY2PwE2Ji8BMDEXIgYdARQWOwEyNj0BNCYjAc4EBwcERgUHBwW0BgRbAwIFPAQKAlsCAgQ9Af5QAgQ9BAICWwIJBT0EAgJbAwJlBAKdBAMCIwMJBJ0BBAICIwP8zwgDIwICBJ4ECgIjAgIEngQCxwQHBgW3BQYGBfwvBQcHBbYFBgYFAk4HAyIBAgIEngQKAiMCAgSeAv3GAwKdAQQCAiMCCgSdBAMCIwYBzwQCPQQCAlsCCgQ9BAICWwP+igcDWwICBD0ECQJcAgMEPI8FBwcFRgUGBgUDUgYFtwQHBgW3BQYvAQaeBAoCIgECAgSeBQkCIwECAiMCCgSdBAMCIwMJBJ0BBqMBWwIJBT0EAgJbAgoEPQcGBj0ECQJbAwIFPAQKAlsC6wYFRgUHBwVGBQYFBwVGBQYHBEYFB5kGPAQKAlsCAgQ9BAkCXAEFAVsCCgQ9BAICWwIJBT0GegEjAwkEnQEEAgIjAgoEnQYCBp4ECgIjAgIEngUJAiM4BgW3BQYHBLcFBgAAAAH/8P9/A+sDRQA5AA9ADCwBAEUAAABmEwEFFSslBgcGJicmJyYnJjc2PwE2NzYeAgcGBwYHBhcWFxYXFjY3PgEnNCcmJy4BBzU2FxYXFhcWFxYGBwYDV0VfWsdaXkRdJSMaGlUQCgkbQi4IDgcJRRoZFhdDSmlixkM1OQEgKVNQzWV1d3VcYC8jAgI4NxAJRSMhBiUnRF1/e32AYxMKBREHLj4bDQlKYF5bXkNKFBJFTT2YUFJMYUA9IiIBKRMTRklwUllXpkUWAAAAAAIAAP/OAfQC7gAOABcAMEAtBgEBRAQBAQIBcAMBAAICAFQDAQAAAlgAAgACTBAPAQAUEw8XEBcADgEOBQUUKxMyFhQCDwEuBDU0NhMyNjQmIgYUFvpoknxAPgoiVkI2kmg4UFBwTk4C7pLS/u5WVAwuhICmQmiS/nxQcE5OcFAAAgAA/5wD6AMgABsAKgA5QDYGAQAFAG8AAQIBcAADBAIDVAAFAAQCBQRgAAMDAlgAAgMCTAEAKCYlIxgWCwkHBAAbARoHBRQrATIVERQrASI1ESMiJyYvASY0PwE2NzY7ATU0MwUWFA8BBiMGIyEnITIWFwGqFBQuFLAQDAwOeAoKeA4MCBSwFAJiCgp2FgQODv7SKAFWEhQQAyAU/KQUFAG4BgIKUgYUBlIKAgS+FNAGFAZSDAbmCAgAAAABAAAAAAJYAdQAFQAZQBYHAQACAUcAAgACbwEBAABmFxQUAwUXKyUUDwEGIi8BBwYiLwEmNDcBNjIXARYCWAYcBQ4G3NsFEAQcBgYBBAUOBgEEBr0HBRwGBtvbBgYcBQ4GAQQGBv78BQAAAAABAAAAAAFMAlEAFQAXQBQLAQABAUcAAQABbwAAAGYcFAIFFisBFAcBBiIvASY0PwEnJjQ/ATYyFwEWAUwF/vsFDgYcBgbb2wYGHAUQBAEFBQE6BwX++wUFHAYOBtvcBQ4GHAYG/vwFAAEAAAAAAV4CUQAVABdAFAMBAAEBRwABAAFvAAAAZhcZAgUWKwEUDwEXFhQPAQYiJwEmNDcBNjIfARYBXgbb2wYGHAUOBv78BgYBBAUQBBwGAiIHBdzbBg4GHAUFAQUFDgYBBAYGHAUABP/0/2oD6ANSADAAOQA9AEYAb0ASPTw7OiUFBAEkAQADCAECAANHS7AkUFhAJwAEAQMBBANtAAMAAQMAawAAAgEAAmsAAgUBAgVrAAUFbgABAQwBSRtAHQABBAFvAAQDBG8AAwADbwAAAgBvAAIFAm8ABQVmWUAJJhMnKSYlBgUaKxcmNzY3NjMyFxE0NjclMzIXFhURFAcGBwYjIiYnJjc2NzYzMhcRBSMRFAcGBwYjIiY3HgE+AS4BDgEBJTUFAR4BPgEuAQ4BChYbJV4nJ0UyHhUCEwwYERYQJV4nJzxeEhUbJV4nJ0Qz/fkMECVeJyc8XigPZnA6IGRwOgFgAhP97QEAD2ZwOiBkcjYtOT1MHw4lAhkXIgVeEBEe/XAjH0wgDTgxOTxNHw4mAXtb/gwkH0wfDjhHKSIoVFIgJFgCSF5dXf2RKSIoVFIgJlQABAAA/2oD6ANTABIAHAAlADEAgkAMGhgDAwQIDgEBBAJHS7AkUFhAKgAIBwQHCARtAAYABwgGB2AABAABAwQBYAADAAIDAlwABQUAWAAAAAwFSRtAMAAIBwQHCARtAAAABQYABWAABgAHCAYHYAAEAAEDBAFgAAMCAgNUAAMDAlgAAgMCTFlADBMhJBMZFBMjFwkFHSsVNDcBJjU0NgQWEAYHIicBBiImNxQWNj8BJicHBgEUFiQ2ECYkBhc0NjcyFCMiBhcUIiEBBCvaATra2p1eUv78IVxANyAuEfwtIfwRAQK2AQS2tv78tl2CWRAQTm4BICkvIQEEUl6a3gLa/sbYASv+/CFALhYiAhD8IS38EQHsgbgCtAEGtAK4gVqAASBsTxAAAAAFAAAAAAPoArYADwAdACAALgAxAD9APDEoISAfHRgHBAUwHhcQBAIDAkcAAAAFBAAFYAAEAAMCBANgAAIBAQJUAAICAVgAAQIBTDQaFTQ1MwYFGis1ETQ2MyEyFhURFAYjISImNxQWFyEyNi8BBwYiLwEHNyc1HwIWMjcBNCYHISIGBRcRSDUC7jVISDX9EjVIPyQaAu4ZJgH0iBo+Goj02tr0G4EQKhABkCQa/RIZJgKR2qMBljNKSjP+ajVISDUaJAEmGbdlFBRlkKSkJ7gTYgwMAS0ZJgEk5aQBSAAAAAMAAP+ZA+gDBgASACUAMQA+QDsFAQUDIAEGBQJHAAcGAgYHAm0AAgJuAQEABAEDBQADYAAFBgYFVAAFBQZYAAYFBkwTISUUHxYSEwgFHCsRNDc+ARc2FhcWFAcBBiInIgEmNxQXARY3ATY0Jy4BDwEnJgYHBhc0NjMyFCMiBhUUIlhU8FhY8FRYWP6mG04bAv6oWD9GAVoVFgFZRkZCvEYrK0a8QkZdTjcQECk8IAHcelhUBFBQBFRY9Fj+qhsbAVZYemFE/qoXFwFWRMJEQgQ+Jyc+BEJEWjdOIDorEAAAAQAAAAAA3AHMAAgAIEAdAgEAAQEAVAIBAAABWAABAAFMAQAFBAAIAQgDBRQrEzIWFAYiJjQ2bi5AQFxAQAHMQFpCQlpAAAAAA//2/2oD9QNSABsAJQA1AF9ADBMEAgQFIyACAwQCR0uwJFBYQBoABAADAgQDYAACAAECAVwABQUAWAAAAAwFSRtAIAAAAAUEAAVgAAQAAwIEA2AAAgEBAlIAAgIBWAABAgFMWUAJFxkUEjsbBgUaKxcmNzY3JicuATY3NiAXHgEGBwYHFhcWBiMhIiY3ISYvAQYiJwcGEwYWHwEWMj8BPgEnLgEiBgQOJ3esVCMKAjAqVAEWUyswBAkjVKx3Jxow/JUVIjcDa22eTy1cLk6gVQ06Qwo4hjgJQzoNDnzUfGkrG04maZY3hqQ4aWk5oog2lmkmThtYGiRJIxAeHhAjAhFn0lEOQUEOUtBocaCgAAAD//8AAAPoArYAHwAvADYAREBBNjAYCQQGBwFHLwEHAUYAAAAFBwAFYAABAAcGAQdeAAQCAwRUAAYAAgMGAmAABAQDWAADBANMERUmNDU1NTMIBRwrNRE0NjchMhYdATc2OwEyFhcRFAYnIyIvARUUBgchIiY3FBYXITI2NRE0JichIgYXAR8BMxEjBzYoAlInNlQUGRsaJAEmGRsZFFQ2J/2uJzhAEA8CUg0SEg39rg4SAQKvH30fH5xkAfQnNgE4JidUESQa/gwbJAERVCcnNgE4Jg4QARINAfQOEAESDf6oH30B9JwABf///6gD6QL1ABkALwA4AEEATQBSQE85AQkIIQECBQJHAAkIBQgJBW0ABQIIBQJrAAAAAwQAA2AABAAGBwQGYAAHAAgJBwhgAAIBAQJUAAICAVgAAQIBTE1MISQYExg4NDo4CgUdKzURNDY/Aj4BFyEyFh8CHgEHERQGByEiJjcUFjMhMjYnETQvAiYjISIPAgYVFzQ+ARYUBi4BNx4BPgEuAQ4BFzQ2NzIUIyIGBxQiLiCHKwwuHgE4Hi4MK4chLgE2KPzUJzhAEA8DLA4SARmqOAgW/sgWCDiqGbuS0JKS0JI/BXiaZgx4mmZFSDUQECc2AR4GAdUjNAUXbBsgAR4cbBcGMiT+Kyc2ATgmDRISDQHVGwQcjBQUjBwEG7tnkgKWypgGjFxNZgx2nGQKeD4ySgEgNicQAAAAAAgAAP9qA6kDUgAPAB8ALwA0AEEASgBTAFgAyEAUS0IzAwwHNTQCCAtYVz86BAYIA0dLsCRQWEBDAAcNDA0HDG0ACAsGCwgGbQAEAAkKBAleAAoADQcKDWAADAALCAwLYA4BBgAFAgYFYAACAAECAVwAAwMAWAAAAAwDSRtASQAHDQwNBwxtAAgLBgsIBm0AAAADBAADYAAEAAkKBAleAAoADQcKDWAADAALCAwLYA4BBgAFAgYFYAACAQECVAACAgFYAAECAUxZQBhWVVJRTk1JSEVEQUAUFhI1NjU0NTMPBR0rFRE0NjMhMhYVERQGIyEiJjcUFjMhMjY3ETQmByEiBhcTETQ2MyEyFhURFAYjISImNyEnAwc1NzYyFxM3NjIfAREhBTQ2Mh4BBi4BNxQeATYuASIGExczNSdINQKvNUhINf1RNUg/JBoCrxokASYZ/VEZJgE+Eg0CcQ4SEg79jw0SHwHjavx9ZgoaC/ZSChoLZf2PAVg2UDQEPEg+IyYyJgIiNiInbGV9GQLuNUhINf0SNUhINRkmJhkC7hkmASQa/a4CMw0SEg39zQ0SEg15AR6RMXUKCv7nXgkJcAGynCc2Nk44AjQpGiQCKDAmJv7Me1KJAAABAAD/iQPoAxMALAAsQCkAAAABBAABYAAEAAMCBANgAAIFBQJUAAICBVgABQIFTBUXFRUbFAYFGis1NDcBNjIWFAcBBiY3ATY0JgYHAQYUFjI3ATY0JgYHAQYmNwE2Mh4BBwEGIiZAAchS6qRS/qgVLhgBUkGCtD/+OixahCsByRs2Thz+qxgqFQFVL4JaAi7+N0C2fmNbQAHDUqTqUv6qFywWAVQ/tIQEPv5ALYBcLQHDG044Ahr+qBYuFQFYLFqELf4/QYAAAAUAAP9qAu8DUgAVACUANQA9AEgAjbUlAQwFAUdLsCRQWEAuAAcACwAHC2AKCAYCBAAABQwABWAADAANBAwNYAAEAAMEA1wACQkBWAABAQwJSRtANAABAAkHAQlgAAcACwAHC2AKCAYCBAAABQwABWAADAANBAwNYAAEAwMEVAAEBANYAAMEA0xZQBZGRUFAOzo3NjMyExMTJjQ1ExMTDgUdKz0BNDY3NTQ2MhYdATIWBxUUBisBIiY3FBYXMzI2NzU0JichIgYXNzM1NDYyFh0BMzU0JiIGFRczNTQmDgEVEzQ2HgIHBiInJjYopOqkJzgBpHW8daQ/gFq8WoABEg79zg4SAV0/XIBcP4Kygl76SGpIPyQ0JAEWDjYOFYPbJzYBfXWkpHV9OCbbdaSkdVqAAYJZ2w4QARINXn1AXFxAfX1agIBafX00SgJGNv6JGSYCIjc4KSk4AAAAAAUAAAAAA+YClgAXACEAKgAzAD8AUkBPHRUCCgkBRwAKCQYJCgZtAAAAAwQAA2AABAAHCAQHYAAIAAkKCAlgAAYABQIGBWAAAgEBAlQAAgIBWAABAgFMPz47OSQTFBMUFBcbFgsFHSsRNTQ3NTYkIAQfARUWFAcVBwYEICQnNSY3HgEkNjcuAQQGFzQ+ARYUBi4BNxQWPgIuAQYXNDYzMhQnIgYHFCICRgEQATQBEkQCAgICRP7u/sz+8EYCQkHsAQjsQUHs/vjslIKygoKygiBsnmwCcJpwQEozEBAlOAEeAVUSAQIEgqamhAIEBgQGBAKEpqaEAgIKcYoChnNxigKGc1qAAoSwhAKAWk5uAmqgagRyTDVIIAE4JhAABAAA/+cD/wLVABAAIQAqADMAO0A4KwEGBAFHAAQDBgMEBm0AAAADBAADYAAGAAUCBgVhAAIBAQJUAAICAVgAAQIBTBQTFTY0NjMHBRsrNRE0NjMhMh8BFg8BBiMhIiY3FBY3ITI/ATYvASYjISIGFwU0PgEeAQYuATcUFj4BLgIGSDUCUkQlnCsrnCVE/a41SD8kGgJSIxGdFRWdESP9rhkmAQIyNlA0AjhMOiEmMiYCIjYiZAH0M0o7+kJC+jtINRkmAR36ISH6HSQa+ic2AjpKOgI2JxkmAiI2IgQqAAAF////agPpA1MANgBGAE8AVACTAghLsApQWEAcBwEGAkYBDwYaAQ4PHgEMDVBHIgMICjABAwUGRxtLsAtQWEAcBwEGAEYBDwYaAQ4PHgEMDVBHIgMICjABAwUGRxtAHAcBBgJGAQ8GGgEODx4BDA1QRyIDCAowAQMFBkdZWUuwClBYQEMACAoFBQhlAAACBgBUAAIQAQYPAgZgAA8ADg0PDmAADQAMBw0MYAsBBwAKCAcKYAkBBQQBAwUDXQAREQFYAAEBDBFJG0uwC1BYQD4ACAoFBQhlAgEAEAEGDwAGYAAPAA4NDw5gAA0ADAcNDGALAQcACggHCmAJAQUEAQMFA10AEREBWAABAQwRSRtLsBRQWEBDAAgKBQUIZQAAAgYAVAACEAEGDwIGYAAPAA4NDw5gAA0ADAcNDGALAQcACggHCmAJAQUEAQMFA10AEREBWAABAQwRSRtLsCRQWEBEAAgKBQoIBW0AAAIGAFQAAhABBg8CBmAADwAODQ8OYAANAAwHDQxgCwEHAAoIBwpgCQEFBAEDBQNdABERAVgAAQEMEUkbQEsACAoFCggFbQABABEAARFgAAACBgBUAAIQAQYPAgZgAA8ADg0PDmAADQAMBw0MYAsBBwAKCAcKYAkBBQMDBVQJAQUFA1kEAQMFA01ZWVlZQCSKiISDfnt6d3RxcG1pZmViXVpSUUpJREE8OTUyKicUJjMSBRcrFRE0NjczMhc3Njc0NhcyFhcUBxYXHgEHFQYHFgcGBxYHBgcWBwYHBisBIi8BIzQrATUGKwEiJjcUFjsBMjY1ETQmKwEiBhcTNDYyHgEGLgE3FDImBhcUFxYXFjsBMjc2NzYmByMiNDsBMj4BNzYrASI0NzMyNzYmJyMiNDczMjc1NCcmIT4BNCYHIhUOAQciDwEGFTYoXiAcIXsCOCY5YAEI7R0rLgECGREGByIQEBEjBwcGCCFOrFxefwIDBBw4Xic4QBAPXg0SEg1eDhIBHxoqGAQgIiIjIAIcexsWe1hUrCkPBgIGEBUxEBAzHyQIBxU8Pw8PSjkMAhYfPQ8PPz0BJS3+3BMKQBwfAlhiAgICGTgB9Cc2ARgQQKInOAGAU0IlBggMPiAXJx0iKTYgJS47GBsbEhA8FR4CAjc2KA4SEg4B9A0SEg3+OxMcHCYeBBYXECACCxcEBh0UHA8IDCABIBQUFEEeAUIWJAEeAS0VJgkMOzJwXAEfXKIpAQEHGgAABwAA/2oD7gNSAB4AKwA5AD8ASQBRAGAAj0AaV1ZRSUU9BgUGRAEEBUwBAwRNLyUABAIDBEdLsCRQWEApAAYHBQcGBW0ABQQHBQRrAAQAAwIEA2AAAgABAgFcAAcHAFgAAAAMB0kbQC8ABgcFBwYFbQAFBAcFBGsAAAAHBgAHYAAEAAMCBANgAAIBAQJUAAICAVgAAQIBTFlADV9dU1IdExYULC0IBRorFTQ2NDY9ARM2NwE1NzYzMhceAQcBBgcFBwYiBiMiJjcUFjMyPwE2JyYPAQY3HgEXPwE2JicuAQcGBzcWFwEmBwMWFxYXASYnJicDFhcVNzU2LwEyFxYXFTc2JyYnJiMiBwICSgoVAUWYPFZqUEoOQf4kGB/++QoECgoELUA/GhQGEHMELy08IAMsQ2YBdAspDjYzgDAHBGMtLQEnWDh6JhsVFAEpEBceJa8RBPI9HsFqUEYINC0EBTk/UDwpKQQICAgCAgELHxYBRAKaO1BKwkD+HxcIRgMBAkAtExwEIDovLQJ3DqQCZEYeBi+INTEUIgoLbwISAScWN/7rFBkWIQErHxgdEP5UKSkY9QI8YNNQSV0WNy1CSjk+KQADAAD/qAPqAxMAGwAyAD4AVUBSJBACAgEBRxgBBAFGAAgHAwcIA20AAwQHAwRrAAIBAnAAAAAFBgAFYAAGAAcIBgdgAAQBAQRUAAQEAVgAAQQBTD49Ojg3NTEwLSsoJyQjEgkFFysRNCQgBAIEJyInDgEHIyImNTQ3ND4DJzUuATcUFhcWHQEUBzY3NjMyFxYzMiQCJiQGFzQ2FzIUByIGFxQiASYBnAEoBP7g0i8xHXg+CQwQAhoKEAoBZnQ+YFkhFTwjEh8EBC0rtgEAAvz+kPxczIwQEH28ASABnZza2v7I3AEHI1YMEAwGBgEoEioeEQI1omBLiCsSJwYpMyUrGAIGuAECtgK6f1mCAR4BckkQAAAEAAD/agLuA1MAEwAmAC8AOABptRkBAQQBR0uwJFBYQCAAAQQBcAADAAYFAwZgAAUABAEFBGAAAgIAWAAAAAwCSRtAJQABBAFwAAAAAgMAAmAAAwAGBQMGYAAFBAQFVAAFBQRYAAQFBExZQA83NjMyLi0qKSUkOBIHBRYrETQ2BBYVFA4CBwYrASInLgM3FB4CFzMWFTc+Ayc0JgQGFzQ2HgIOASY3FBY+ATQuAQbaATraOHJYQhQdBB0UQlhyOD84ckw+AgIEPkxwPAG4/v64fmyebAJwmnAhXIBcXIBcAduc3ALYnk6kqHJMGRlNcKqiT0icplpLAgIESV6ioEaBuAK0e05uAmqgagRyTEFcAliGVgZiAAAABgAA/2oDawNSACUAKQAtADEANQA5AKRLsCRQWEA3AAYABQQGBV4ABA4JAwMBCAQBYAAIDwELCggLXgAKEAENDAoNXgAMAAIMAlwABwcAWAAAAAwHSRtAPQAAAAcGAAdeAAYABQQGBV4ABA4JAwMBCAQBYAAIDwELCggLXgAKEAENDAoNXgAMAgIMUgAMDAJYAAIMAkxZQCI2NjIyLi42OTY5ODcyNTI1NDMuMS4xEhERERImNig2EQUdKxE1NDY/ATYzITIfAR4BFxUUBgcjFxYVAw4BByEiJicDND8BIyImNyE1ITchJyERFyE3BRMhEwEXITciGScNLQIzLQ0nGCIBJhkhAQE+BCQX/ksYIgU+AQEhGiQ+Au39Ez4CcR/9zQoCHwr92yMB0SP+EAoBtQoCGl0aIgNxKytxAiQZXRokAQMDAv3OGB4BIBcCMgIDAyYZXT9d/sheXn3+yAE4/qheXgAKAAD/agNrA1MAIQArADUARQBJAFMAYwBnAHcAewDBtWg2AgwBRkuwJFBYQD4OAgIAAAcGAAdgAAYJBQIDCgYDYBQQAgoXEwINDAoNXhYSAgwVEQILCAwLYAAIAAQIBFwADw8BWAABAQwPSRtARAABAA8AAQ9gDgICAAAHBgAHYAAGCQUCAwoGA2AUEAIKFxMCDQwKDV4WEgIMFRECCwgMC2AACAQECFQACAgEWAAECARMWUAqe3p5eHZzbmtnZmVkYl9aV1FPS0pJSEdGREE8OTU0NTMSEzMVIzMjGAUdKxE1PgEXMzU0NhchMhYXFTMyFhcVFAYHERQGIyEiJjURIiY3ITU0JgchIgYXExQWMyEyNjcRIRMRNDY7ATIWFREUBisBIiY3MxEjEyE1NCYHISIGFRMRNDY7ATIWFREUBisBIiY3MxEjExE0NjsBMhYVERQGKwEiJjczESMCNiZeNicBOSc2AV0lOAEmGUg0/gw1SBokPgLtEA/9UQ4SAT4mGQH0GSQB/Y8/EA8+DhISDj4OEiA+Ph8BdxIN/scNEn0SDT8NEhINPw0SHz8/nRAPPg4SEg4+DhIgPj4COUQlNAEfJzgBNigfMiZEGiQB/e01SEg1AhMmGT4OEgEQD/1wGSYmGQIT/gwBlw0SEg3+aQ0SEg0BlwE4Hw4SARAP/RIBlw0SEg3+aQ0SEg0Bl/5pAZcNEhIN/mkNEhINAZcADwAA/2oD6QNTABQALwA4AEEATABVAF4AbgByAHsAhACPAJgAoQCqAURAFGcBABEvAR0GikcCDAsDRyoBBwFGS7AkUFhAbwAAFAYAVAARABQfERReAB8gAQYdHwZgAB0AHhMdHmAAExsSE1IAGxwBEg8bEmAADwAQDQ8QYAANAA4LDQ5gGQELGgEMCQsMYBcBCRgBCgcJCmAVAQcWCAIFAwcFYAADAAIDAlwABAQBWAABAQwESRtAdQABAAQRAQRgAAAUBgBUABEAFB8RFF4AHyABBh0fBmAAHQAeEx0eYAATGxITUgAbHAESDxsSYAAPABANDxBgAA0ADgsNDmAZAQsaAQwJCwxgFwEJGAEKBwkKYBUBBxYIAgUDBwVgAAMCAgNUAAMDAlgAAgMCTFlAPKqnpqOhnp2amJWUkY+MiYaEgYB9e3h3dHJxcG9ta2ViXltaV1VSUU5MSUZDQT49OjE0IxU1NDUzIyEFHSsVETQ2NzM1NDYXITIWBxEUBiMhIiY3FBYzITI2JxE0JgchIgYXERQGIiYnESMiBhcTNDsBMhQHIyI1NDsBMhQnIyI1NDsBMhUUBicjIjU0MyEyFCMhIjU0MyEyFAchIj0BNDY7ATIWFxUUBgcjIiY3MzUjATQ7ATIUByMiNTQ7ATIUJyMiNTQ7ATIVFAYnIyIRNDsBMhQnIyI1NDsBMhQnIyI1NDsBMhQHIyI2KB82KAKvJzgBSDX9EjVIPyQaAu4ZJgEQD/1RDhIBEhwQAR8OEgG7EPoPD/oQEPoPD/oQEPoPCgX6EBACURAQ/a8QEAJREBD9rxASDdsOEAESDdsNEj+cnAEZD/oQEPoPD/oQEPoPD/oQCgb6Dw/6EBD6Dw/6EBD6Dw/6EBD6DxkCcSc2AT4nOAE2KPzzNUhINRkmJhkDDQ4SARAP/RINEhINAnESDf2fDx4BbRAgAW0QEAYKAW0QIG4PHgF92w0SEg3bDhABEiyc/WEPHgFtECABbRAQBgoBASgQIAFtECABbQ8eAQAABAAA/2oD6QNSACAAOwBPAFcAkEAYVlRSRjw6LwcICQ8BAQgQAQcBOwEGAgRHS7AkUFhAKgAIAAEHCAFgAAcAAgYHAmAABgADBQYDYAAFAAQFBFwACQkAWAAAAAwJSRtAMAAAAAkIAAlgAAgAAQcIAWAABwACBgcCYAAGAAMFBgNgAAUEBAVSAAUFBFgABAUETFlADjY1JSMiEjIjJSMYCgUdKxU1NDcBJjU0NiAWEgYnIicHFRQGJyMVFAYrAQcGKwEiJjczNzY7ATU0NjczNTQ/ARYzMjY0LgEGFxQXCQE0NzY3NhcWFxYVFAcGBwYnJicmNxYXNjcmJwYSAXsWuAECtgK6fzk5SiYYPyYYSS0RFl0aJD5XLRIbSSQaPxFqPENnkpLOlAEj/mYCMgIXQQ8MSjUGAhdBDwxKNQYfM0QzEjFGM1heFBMBezk5gLi4/wC6ARZJShkmAT8ZJiwSJhgtEj8ZJAFKGhFqI5LQkAKUZkM8/mcCbwQGQRcGCjVKCAkEBkEXBgo1SggJRjESM0QzEgAI////aQNrA1MACwAXACMALwA4AEEASgBTAMVAFy8qAggJSyMeAwYMQhcSAwQLOQECCgRHS7AkUFhAQgAMBwYHDAZtAAsFBAULBG0ACgMCAwoCbQAIAAcMCAdgAAYABQsGBWAABAADCgQDYAACAAECAVwACQkAWAAAAAwJSRtASAAMBwYHDAZtAAsFBAULBG0ACgMCAwoCbQAAAAkIAAlgAAgABwwIB2AABgAFCwYFYAAEAAMKBANgAAIBAQJUAAICAVgAAQIBTFlAFE5NRUQ8Ozc2FRUVFRUVFBUTDQUdKzURNCwBBBcRFAwBJDcUFiA2NzUOAS4BJzUUFiA2NzUOAiYnNRQWIDY3NQ4BLgEnNRQWID4BJiQGATQ2Mh4BBi4BNzQ+AR4BBi4BNzQ2Mh4BBi4BAQYBYAEEAf76/qL++EDaATrYAS7Q8NIt2gE62AEu0PDSLdoBOtgBOszgzjnaATrYAtz+yt4CcxAeDgQWFhgEEB4OBBYWGAQQHg4EFhYYNQJSYmgCbGD9rmJoAmxgO1JSO3UwNgIyMkc7UlI7dTE0AjgvRjpSUjpsLTACLC9vO1JSdlACVP1mDRISGhQCEMoOEAIUGBQCEMoNEhIaFAIQAAAGAAD/agPpA1IALwA6AEYAVgBhAHMAvEAWFAENBB4BAg1AAQcCA0dRAQBNAQQCRkuwJFBYQDMPAQAMCgIGBQAGYAsJAgUSEBEIBAQNBQRgAA0AAgcNAmAABwADBwNcAA4OAVgAAQEMDkkbQDkAAQAOAAEOYA8BAAwKAgYFAAZgCwkCBRIQEQgEBA0FBGAADQACBw0CYAAHAwMHUgAHBwNYAAMHA0xZQCpiYjs7YnNicm9ta2lmZGBeW1lVUkxJO0Y7Rj8+OTc0Mi4sJyQjJDITBRcrETQ2MyEyNjczNjMyGgECJyInIyYnBiMVBgcGFQYdARQWHQEUBgcjIiY3ETQmByImNxQWOwEmNDcjIgYXFhURMzUnJj0BNDcnFBY7ATIXJjU0NwYrASIGBRQXMzI2LgEnIwYXHgE3MjYCJiciBgczMhYOASdINQEhP3AoAjpcZnQCeGRcOgJOeQYCBgQCBCAmGX0ZJgEmGTVIPyQa2x8f2xkmqhJ9BBsGBiQaCFZMDQ1MVggZJgEaBlgZJgIiG1gGDhNML0FcAlhDL0wTUDRKAkY2AZ1CWlpQb/76/qL++AFvmw0CAgIFAgIGBt0IJBIgGSQBJhgBGhkmAVpDKDYlciQ2xB0h/uYcBCEd2xAPnSg2P0pTUEw/NicvLzZQNAEvy2F6AdoBOtgBeGJahFwBAAAFAAD/qAPpAxMAGAAlADMAPQBJAFdAVBUOAgIDRAEFAj4BCQUDRzMuAgIBRgAJBQQFCQRtAAAAAwIAA14IAQIABQkCBWAABgEHBlQABAABBwQBYAAGBgdYAAcGB0xIRxUUFRYWFRobFQoFHSsRNDY3JTYyFwUeAgYPAREUBiAmNREnLgE3FBcFMyU2NCclIwUGExQeATI+AT0BBQYiJyUBNDYyFgcUBiImNxE0NjIWBxEUBiImKh4BlwsUDAGWHygCLB1UqP6gqFQfKD4XAZYQAZYXF/5qEP5qF5w6iK6IOv79DBQL/vwCkCgsKgEmMiQeEhoUARIcEAJYITQHXgEBXggyRDIIE/74RFhYRAEIEwgyIhkGXl4GMgZeXgb+cBQoIiIoFPo9AQE9/gwfXl4fGSYm1QEZDRISDf7nDhISAAMAAP9qAsEDUgAfADkAZAA/QDxgXVtYVUpFQkA9NjIwLSsVEQ0LBRQDRQADAgNvAAIBAm8AAQAAAVQAAQEAWAAAAQBMZGNPTiQiHhwEBRQrNTQ+ASYnFx4DFzY3Fx4BBzc+AScWEgcOAwciJjcUFhcyPgM3NicGBzQmJwYHNC4BJxYHBhc0PwEXFhc/ARUUFz4CPwEXFgcGIyInJjc2JwYPAScmJw8BJyYnBhUUIiQeBB8UE0BAQg8/Ah8dQAEPECIBYE4dDiJOiGWJsD+KcEpsPCYQBidnPVQUDxdaGEArCCkfMikQEBMvMS8XJzocFhsGFSkECQQCDgYbCDpgDwYYBDoQDCsVGSCHTLaC0nUODT5MdjteXCMkjEUUFU4kd/74dTNCRh4CqnNYhgEWHjYiIJ+5Z0VcqB06fwhWnjp9uY9pknUvKThsSks1QkUUKh4ZHiB3YwoCBg1JX0IvBhBCLVQVF2IzVIUQAAAE//7/agPqA1IAFgAcAB8AJAA3QAwkIx8eHBsPBwEAAUdLsCRQWEAMAgEBAAFwAAAADABJG0AKAAABAG8CAQEBZlm1FBcUAwUXKzUmNwE2MhcWBwMGBwYiJyUHBiIvAiY3FxYfAQkBFwkBFhcFEwIQA6kIFAgPApwEDAcOBv7RQAokCXP0EmC9AgMDAg/+CVcB+P5oDAgBCX2/EgoCcQYGChX8Vg0IBAJ5axAQyWEIHk0CAQICNP22mAMT/UcCAmwC7AAAAgAA/+YD6AK2ABkAPQAzQDAnAwIDBQFHAAEABAABBGAAAAAFAwAFYAADAgIDVAADAwJYAAIDAkwZKjQ3IycGBRorNTQ2NyY1NDY3Mhc+ATMyFhceARcUBichIiY3FBYzITI2JzQmJy4BJy4BByIGBw4CJicmByIGBxQXFgYHBjYwCFI6FBciiFRungxSagGIYv3NVHY+UjoCM0ZmAU48Iw4CCHxVPm4ZCgQMEg0VFiEsAQQOCCFGsjdeGxUWOlIBCEpakmwQgFdhigF4UzpSZEc/XgsIDiNUcgFEOxMKEAQECgIsIgoOIRYTKQARAAD/hwPKA1MACAAPABYAHAAiACgALgA0ADoAQABGAEwAUgBYAF4AZQBsAMlAJmtdW1FPMhsZFRMKCABKLQIHCEMlAgkEYVdVPjs3IR8NCwoBCQRHS7AkUFhALwABCQFwDwEIDgEHAwgHYBENBgMDEAwTBRIFAgQDAl4LAQQKAQkBBAlgAAAADABJG0A3AAAIAG8AAQkBcA8BCA4BBwMIB2ARDQYDAxAMEwUSBQIEAwJeCwEECQkEVAsBBAQJWAoBCQQJTFlALSMjCQlpaGRjTk1MS0hHRkVCQUA/OjkxMCwrKikjKCMoJyYREAkPCQ8TEhQFFisRNAAkAAIAJAA3Fhc2NyYvATM2NyYnBjcWFzY3BgMWFyYnBhMWFzY3NSczNSYnBjcWFzUjBgMWFzM1BhczNjcmJzUWFzY3IzUzJicGBzU2NyYnIxM2NyYnBgMWFzY3JgMWFzY3IwYDFhczJicGARwBkAEeAv7m/mz+6D0HdjQ5KwS7uwQhPjdmezM5K0qDSlh1QCk1FwQpRUq8vE5LHytFSAJaJTFOAkVkAk4xPURKRSkEvLwEIEpOSEUxWgI1dVgvNSlASis5Ml0MOTR1CLsEISEEuwZlNwFuyQEaAv7i/nL+4AQBGLumdSUXanUfaFwZK3GIJxdlSxb9NUwTQFQTAQ9vZhYEux+dAxpYdRcE2kz9p2RCuwS3QmQRBCAEFmZvH2JYGgMfBBdzTPy7E0wiE1QDAEtlFydc/YcXJXWmdQFYXGiXcSsAAAAEAAD/qAPoAxQAFQAhADcAQwBPQEwhHgEDBQgBRwAAAAMEAANeAAQACwgEC14KAQgHAQUJCAVgAAkABgIJBmAAAgEBAlQAAgIBWAABAgFMQ0JBPz08IiIyJDQUNDg2DAUdKz0BNDcTPgEXITIWFxMWHQEUBgchIiY3FBY3ITI2JzUDIQM3EzYzITIXExYGByMHBisBIi8BIyImNzMyHwEzNzY7AQMhAn0GIBcCcBYiBX0CSDX9EjVIPyQaAu4ZJgF9/ZB9OmwFGAHkGAVsBBIPjy0RKNIoES2PDxIxfycSLdItEid/XP4cJtoICgHVExoBGBT+KwoI2jVIAUo0GiYBJBvaAdX+KwgBdxcX/okQFgFaIyNaGCckWVkkAVcAAAAIAAD/agPkA1IACAARABoAIwA7AEQASABMAPC2LCkCEAkBR0uwJFBYQEcACwAMCAsMXhEKAggAEhMIEl4AExUPAg0UEw1eABQADgAUDl4YBBYDAAcBAwIAA2AZBhcDAgUBAQIBXBoBEBAJVgAJCQwQSRtAUAAJGgEQCwkQYAALAAwICwxeEQoCCAASEwgSXgATFQ8CDRQTDV4AFAAOABQOXhgEFgMABwEDAgADYBkGFwMCAQECVBkGFwMCAgFYBQEBAgFMWUBDPTwcGxMSCgkBAExLSklIR0ZFQUA8RD1EOzo5ODc2NTQzMjEwKyolJCAfGyMcIxcWEhoTGg4NCREKEQUEAAgBCBsFFCs3IgYUFjI2NCYHIiY0NjIWFAYlIgYUFjI2NCYHIiY0NjIWFAYTIy4CJzUjFQ4CByM1IxUzETMVITUzATIeARchPgIFIRUhBSE1IcMpOjpSOjopEBYWIBYWAoUpOjpSOjopEBYWIBYWfOUHOlw2PTZcOgeocDMpA1sp/iosTTMH/pkHNE3+kgMz/M0DCv0fAuEwOlI6OlI6iRYgFhYgFok6Ujo6UjqJFiAWFiAWAqM2XDoHNTUHOlw2jz3+aZqaAd0oRSsrRSjVy5lcAAAAAgAA/2gD0QNQABQAKQBGth4JAgABAUdLsB9QWEAXAAIBAm8AAAEDAQADbQADA24AAQEMAUkbQBMAAgECbwABAAFvAAADAG8AAwNmWbYcFxwSBAUYKwkBBiIvASY0NwkBJjQ/ATYyFwEWFCUBJiIPAQYUFwkBBhQfARYyNwE2NAJG/i0KGgoyCgoBiv52CgoyChoKAdMKAXf+LQoaCjIKCgGJ/ncKCjIKGgoB0woBRf4tCgoyChoKAYoBigoaCjIKCv4tChokAdMKCjIKGgr+dv52ChoKMgoKAdMKGgAAAAAE////iQPpAzMAHwAvAD8AQwCLQBAvAQYFJwEEBxsYDgMCAQNHS7AKUFhALwACAQECZAAAAAUGAAVgAAYACQgGCV4ACAAHBAgHYAAEAQEEVAAEBAFYAwEBBAFMG0AuAAIBAnAAAAAFBgAFYAAGAAkIBgleAAgABwQIB2AABAEBBFQABAQBWAMBAQQBTFlADkNCEiY2NTQmNiUzCgUdKzURNDY3ITIWBxEUBgchFRcWFRQGIyEiJjc0PwE1ISImNxQWFyEyNicRNCYnISIGFxMRNDYzITIWFREUBgchIiY3IREhNigDLCc4ATYo/sjDFxAP/c4OEgEXw/7IJzhAEA8DLA4SARAP/NQOEgE+Eg0CsA0SEg39UA0SHwKw/VBkAnEnNgE4Jv2PJzYBJRkGGg0SEg0aBhklOCYOEAESDQJxDhABEg3+DAG1DhISDv5LDhABEg0BtQAAAAr/3P/HBAwC1QAbACMANgA+AEwAVQBeAGcAcAB1AWhAD3EBERJKPwIIBxYBAgEDR0uwCVBYQF4AAAQAbwAEDwYEYwAIBw0HCA1tAAUKAQoFAW0DAQECCgFjAAICbgAPABIRDxJgABEAEAcREGAABgAHCAYHYQANAA4LDQ5gAAsADAkLDGAACQoKCVQACQkKWAAKCQpMG0uwClBYQF8AAAQAbwAEDwYEYwAIBw0HCA1tAAUKAQoFAW0DAQECCgECawACAm4ADwASEQ8SYAARABAHERBgAAYABwgGB2EADQAOCw0OYAALAAwJCwxgAAkKCglUAAkJClgACgkKTBtAXgAABABvAAQPBG8ACAcNBwgNbQAFCgEKBQFtAwEBAgoBAmsAAgJuAA8AEhEPEmAAEQAQBxEQYAAGAAcIBgdhAA0ADgsNDmAACwAMCQsMYAAJCgoJVAAJCQpYAAoJCkxZWUAldXRzcm9ua2pnZGNgXltaV1VSUU5MS0dFREM0MyopFBQYFRMFGCs3AhM2NzYgFxYXEgMGBwYHFhUUBi4BNTQ3JicmNwQlEgMkBQIXJjc2NzYyFxYXFhQHBgcGIicmNxY3NicmBwY/ATY/ATIUJwcGDwEUIgU0OwEyFCsBIjc0OwEyFAcjIjU0OwEyFCcjIjU0NjIWFAYiJjcUMjYiJEhICivNAZrNLQpISAwrXmcGgrKCBmdeKzMBkgGURUX+bP5uRYFCQgYSgf6AEgYhIQYSgfyCEhr4+kBA+vhBfwgED48QEHUQAgYeAfMQXRAQXRAfEF4PD14QEF4PD14QHCYcHCYcIB4CIi8BLwEvKwQZGQQr/tH+0SsECwYEBA4SAg4QBAQGCwQ7MzMBHwEfMzP+4cvPzRIDGhoDEmbOaBIEGRkEHDMzxcM1NcMMWA0CDCABCAIQOhDLECBuDx4BbRAgAcsTHBwmHBwTECAACAAA/2oD6AMzABMAKgA/AEUASQBNAF0AZgCUQJEtAQoLQAEHCjgqAgUHCQEEBVYBEAReARIRBkcMAQMBRgAAAAgGAAhgAAYADg0GDl4ADQAMCw0MXgALAAoHCwpeCQEHAAUEBwVgAAQAEBEEEGAAEQASDxESYAAPAAMCDwNgAAIBAQJUAAICAVgAAQIBTGVkYWBcWVJQTUxLSklIR0ZFRENBJRM3MyMjNDkzEwUdKzURNDYzITIWFREWFAcVFAYjISImNxQWFyEyNic1ISImNDYzITU0JiMhIic1FBc1NDYzITIWHQEyFzU0JichIgYXFjMhNSE1ITUhNSE1IQEUFhchNjU0JxUHBiMhIgYXNDYyHgEGLgFmRgKAKDZeXmZG/c5GZj9ALQIyLUIB/udBXFxBARkSDv2APy4fEg0CkA4SDxASDv2ALUA+FxgCYf1wApD9cAKQ/XABWDYoAUA2IwcUH/7nKDYfJjIkAiguKhYCcUZmOCb+50fqRi9GZmZGLUABQiwvXIBcPw0SJ4UtH3sNEhINnAbBDhABQI8LHx8fHyD+Kyc2ATNKOy0CDhk4JhkmJjImAiIAAAAAA//2/6gD8gMTACEAMQA3AE1ASikoJyQjGxIHAQYBRwMBAQYEBgEEbQAACgkHAwUIAAVeAAgABgEIBmAABAICBFIABAQCWAACBAJMMjIyNzI3ExISFBckNCg0CwUdKxMmPwE2MyEyHwEWDwEGBwYjIicRFAYjISImJxEGIyInJi8BFzcRIREXNycjDgImJyMzHgEyNjcEDiKcERYCMhYRnSEOPgodCgoSDSYZ/c4aJAENEgoJHgkEPl4CMl4/nYMNUm5SDYOkDj5SPg4CRCkcfQ0NfRwpux0KBAj+gRkmJhkBfwgECh3Puz7+DAH0Prt9KTQCOCcbJCQbAAAABv///2gCsANTABgAJgAyADgAQQBIAIW3SDs1AwgHAUdLsCRQWEArAAYFAgUGAm0ABAAFBgQFYAACCQEHCAIHXgAIAAEIAVwAAwMAWAAAAAwDSRtAMQAGBQIFBgJtAAAAAwQAA2AABAAFBgQFYAACCQEHCAIHXgAIAQEIVAAICAFYAAEIAUxZQBIzM0ZEMzgzOBMhJBYdHBIKBRsrETQ2JBYVFA4BBwYPAQ4CLgQnLgI3FBcWFyE2NzY1NCYiBhc0NjMyFCMiBhcUIhMWFzc2NwcWFzc2Nz4BNwceATMyNjfKARzKPFIPDxAYCCYuUDAiEiAQDVQ8QFIlDwElECVSpOqkXW5ODw9BXAEgQwsI1QII1QoImgYGAgQBogwaGR0cDQH6j8gCzI02hpIrJzdSGzQaBBI8LnYjK5SCOECVQCMjQJc+daSkdU5uIFpCD/6YIRsbDBVaIxkTEBYFFAJxGg4UIwAMAAD/agKwA1IAIwAsADUAPgBHAE0AUwBcAGgAcQB7AIQBH0AgUQEFCmkBBw4/AQEHXS0CBgFyNgIMAlQBBAxLAQkEB0dLsA5QWEBCAAcOAQ4HAW0ADAIEBAxlAAoABQ4KBWAADg0BBgIOBmAAAQACDAECYAAEAAkIBAlhAAgAAwgDXAALCwBYAAAADAtJG0uwIVBYQEMABw4BDgcBbQAMAgQCDARtAAoABQ4KBWAADg0BBgIOBmAAAQACDAECYAAEAAkIBAlhAAgAAwgDXAALCwBYAAAADAtJG0BJAAcOAQ4HAW0ADAIEAgwEbQAAAAsKAAteAAoABQ4KBWAADg0BBgIOBmAAAQACDAECYAAEAAkIBAlhAAgDAwhSAAgIA1gAAwgDTFlZQBhsa2dmV1ZTUlBPTUwXHRgTFzcTRTUPBR0rETQ/AT4BNzMyFh8BFhc3NjMyFhQGJyMnBg8BDgEHIyImLwEmNxQWPgIuAQYXND4BFg4BLgEXNDYeAg4BJhM0NjIeAQYuARMXMzcGIgM2MhcnIxM0NjIeAQYuATc0PwE2Fg8CBiImNzQ2Mh4BBi4BEzQ2HgEHFA4BJjc0PgEWFAYuAVYrBCIY+hYiBS05DwICAhkmJhkEAhE7LQQgGPoYIAUtUj+S0JAEmMiaIxIaFAQMIgoyEhwQAhQYFgISHBACFBgWCiD6H0qkR0qkSyD6WhIcEAIUGBYCCqIIDARMOwgaFAESHBACFBgWhxIYFgEUGhA2EhoSEhoSAV55XOwWHAEeFfRAUAEBJjImAQFUQPAWHAEeFfBad2eUApDSkAKUZw4QAhQYFAIQdg0SAg4eDgYaARINEhIaFAQM/n+pqSsCRioqp/2QDRISGhQCEMoOCIYGDgdeRggSyQ0SEhoUAhD+zw0SAg4QDBICFo8OEAIUGBQCEAAQAAD/5wPoAtUAEwAXABoAHQAgACMAJwAqAC0AMAA0ADcAOgA9AEAARACEQIFEPz00MzIvLScmJSIgFxYPAgYpHBkDAQMCRwABAwFwAAAUDRMJEQUGAgAGXg4MCAUEAgMDAlIODAgFBAICA1YLChIHEAQPBwMCA0o+Pi4uKCghIRsbGBhDQj5APkA8Ozo5NzYuMC4wLCsoKigqISMhIx8eGx0bHRgaGBoUGDQVBRcrETQ/ATYzITIfARYVFAcBBiInASY3MzcnBwEDMxMDJzMvARc3Bxc3JxcbASczLwEXNwcXNycDEyMDASMnMy8BFzcHFzMnEqARGgIuGhGgEhD+SxQ2FP5LED+GVEh3ATPEI+dMl49OPz0zHFBHVh9OTpSMRkZGRCtFUEFM55sFATJvto9BMTM9J1SFkQH2HBGeFBSeERoXFP4vFRUB0RIbVD2w/rgBSP6BAX8fQVsyMkZCOke0/nsBhR85Yzo6TjpCP/3NAX/+uAFIH0FbMjJIVJEAAAAACv///2oD6ANSACMALwA9AEEARQBJAE0AUQBVAGEAzkAQDwYCBQxbAQQFAkc5AREBRkuwIVBYQDoADBkXGBUTDwsHBQQMBV4WFBIOCgUECQMCAQcEAWAABwARBgcRXhAIAgYAAgYCXAANDQBYAAAADA1JG0BCAAAADQwADV4ADBkXGBUTDwsHBQQMBV4WFBIOCgUECQMCAQcEAWAABwARBgcRXhAIAgYCAgZSEAgCBgYCWAACBgJMWUAyVlZSUlZhVmBZV1JVUlVUU1FQT05NTEtKSUhHRkVEQ0JBQD8+PTwTJBUhJBMzGzkaBR0rETU0PwE2NzU0NjchMhYXFRYfARYdARQGIxEUBgchIiY3ESImNxQWOwE3IyIPAQYVEzMRNDY3MzIWFxEzESE3MzcjJyE1IRMzNSMDMxEjNzMnIzMXMyczFzMyNic1NC8BJiMUXQQIJhkCcBokAQgEXRQ2KCQa/VAZJgEnOEAQDzp9WRAKXgVdyxIO6g4QAbz9UCCCP0R9AnD9kKSERhfq6n2EPkZnP4J8I306DhIBBV4KEAGdHx8ZfQYIlBokASYZlAgGfRkfHyg2/mkZJAEmGAGXNigOEtsMfQkK/ewBOQ4QARIN/scBlz7bPn3+atv9UAE5nNvb29sSDh8KCX0MAAAAAAYAAP9qA/oDUgAYACUAKwA4AEkAVgCqQBgsAQoGKgEMCkQBCwwrIgMDBAggAQEEBUdLsCRQWEA0AAsMCAwLCG0ACAQMCARrAAoADAsKDGAFAQQAAQMEAWAAAwACAwJcCQEGBgBYBwEAAAwGSRtAOgALDAgMCwhtAAgEDAgEawcBAAkBBgoABmAACgAMCwoMYAUBBAABAwQBYAADAgIDVAADAwJYAAIDAkxZQBRWVFFQTUtIRhQnFCQaGBImKA0FHSs1ND8BETQ2NzYzMhcBFgcOAQchBwYiLwEmNxQfARYyPwEzARUHBjcBNyEBGQEBMzI2JwEmIyIHBhUlNDYzMgAVFAYiJjc0JiMiJhc0MzIWFRQiNzQmIyIbYiAbDxQnGwKwLRoKLh7+U2IbThzbGz8J2wgcB2IC/vhiCXsBFQ4Bef1mAsQKFhAQ/VAIDQYGEwFXEg61AQASGhQB3JoOEhAQgLggAaR1EKMnG2IBrR4uCggb/VAtOBweAWIbG9sbKA4I2woKYgEIAmIIif7rAgKa/ocBo/08Jg4CsAkBCBY/DRL/ALUOEhIOmtwSYBC4gBAQdaQAAAAAC////2kD6QNSACcATwBTAFcAWwBfAGMAZwBrAG8AcwEkQApPAQoJLwEIEQJHS7AkUFhAUQYEAgMADw0LAwkKAAlgIBoCFCohJxskBRUSFBVeHhgCEikfJhkjBRMQEhNeHBYCECgdJRciBREIEBFeAAgABwgHXA4MAgoKAVgFAwIBAQwKSRtAVwYEAgMADw0LAwkKAAlgBQMCAQ4MAgoUAQpgIBoCFCohJxskBRUSFBVeHhgCEikfJhkjBRMQEhNeHBYCECgdJRciBREIEBFeAAgHBwhUAAgIB1gABwgHTFlAYnBwbGxoaGRkYGBcXFhYVFRQUHBzcHNycWxvbG9ubWhraGtqaWRnZGdmZWBjYGNiYVxfXF9eXVhbWFtaWVRXVFdWVVBTUFNSUU1LSEdEQ0A/PDs4NzQyNDUjExMTExMjKwUdKxURNDYXMzU0NjIWHQEzNTQ2MhYdATM1NDYyFh0BMzIWBxEUBichIiY3FBYzITI2JxE0JisBFRQGIiY9ASMVFAYiJj0BIxUUBiImPQEjIgYXEzUzFSc1MxUnNTMVEzUzFSc1MxUnNTMVEzUzFSc1MxUnNTMVMCSHEhoSvBIaErwSGhKHIzIBMCT8wCMyQAoLA0AKDAEKC4cSGhK8EhoSvBIaEocKDAGcfX19fX1efX19fX1dfX19fX1CAuIjMgE/DRISDT8/DRISDT8/DRISDT8wJP0eIzIBMCQKDAwKAuIKDD8NEhINPz8NEhINPz8NEhINPwwK/aVeXpxeXpxeXv7IXl6cXl6cXl7+yF5enF5enF5eAAAAAAoAAP9pA+kDUgAlADMAQQBWAGQAcgB6AI0AowCoAqJLsApQWEAogAEXFZMBFglQARgWPAoCFA9fOwISFKhta14EABIvLicmIxoGBAUHRxtLsAtQWEAogAEJFZMBFglQAQoWPAoCFA9fOwISFKhta14EABIvLicmIxoGBAUHRxtAKIABFxWTARYJUAEYFjwKAhQPXzsCEhSobWteBAASLy4nJiMaBgQFB0dZWUuwClBYQFgAEhQAABJlABcAGAoXGGAACQAKAQkKYAABAAgHAQhgAAcADQwHDWAADAAQDwwQYAAPABQSDxRgGRMRDgsGAgcAAAUEAAVhAAQAAwQDXAAWFhVYABUVDBZJG0uwC1BYQFIAEhQAABJlFwEJGAEKAQkKYAABAAgHAQhgAAcADQwHDWAADAAQDwwQYAAPABQSDxRgGRMRDgsGAgcAAAUEAAVhAAQAAwQDXAAWFhVYABUVDBZJG0uwJFBYQFgAEhQAABJlABcAGAoXGGAACQAKAQkKYAABAAgHAQhgAAcADQwHDWAADAAQDwwQYAAPABQSDxRgGRMRDgsGAgcAAAUEAAVhAAQAAwQDXAAWFhVYABUVDBZJG0uwJ1BYQF4AEhQAABJlABUAFhgVFmAAFwAYChcYYAAJAAoBCQpgAAEACAcBCGAABwANDAcNYAAMABAPDBBgAA8AFBIPFGAZExEOCwYCBwAABQQABWEABAMDBFQABAQDWAADBANMG0BfABIUABQSAG0AFQAWGBUWYAAXABgKFxhgAAkACgEJCmAAAQAIBwEIYAAHAA0MBw1gAAwAEA8MEGAADwAUEg8UYBkTEQ4LBgIHAAAFBAAFYQAEAwMEVAAEBANYAAMEA0xZWVlZQC6lpKKgl5WNi4OCenl4d3Z1dHNxb2loZmVjYVxaWFdUUktJJSIRNDk4KyIiGgUdKzU0NjczPgEzMhYXNzYeAQYPARYXMzIWBxQPARUUBichIiYnNScmNxcVFDMhMj0BNzQjISI3Mz4BMzIWFzcuASMiBjcmNzYnIzU0MzIXFgcGFxUUIyInNRMzPgEzMhYXNy4BIyIGFzM+AhYXMzcuAQciBhczNjIXMyYiEzUmNzYnNTQyFxYHBhcWFRQjIhc1Jjc2JzU0MzIXFgcGFxUWFRQjIicTMzQmNS4gVBa+fmaoKo8MGAoGDZYEAlQhLgEQbSwi/a4hLAFtED99DwJSD30P/LQPgiIVmGRUiiIbJZheb64hECAZDAIQCgQRHxkNDwoECCEUcktCbBkeIHpLVoYsIRJOXk4SBRgWXDo9XjAlHVIbJyWMJxAdHA4aAxIfGgwCEAmaECAZDhAKBBEfGgwCDwoEnhICdCEsAXmgbllGBggYFgdMCwouIBgRexghLgEsIhh7ERiNLxAQL40PP198XEoPUmSQuSdKPR0GDwkpST4dBBAIAv7dRFhIOw5CUmhTKzICNikLM0ABRjcfHz4BbwInSzweBRAKKUg/HQICD38CJ0g+HAYPCShKPB4CAgEQCv7ZAgQCAAAAB//5/2QD8QNYACEAMgBHAJAAmwCwALsANkAzimwCAQKziHlwBAABAkeZl5FkYkwsBwJFJAEARAACAQJvAAEAAW8AAABmurmNi3x7AwUUKzc2NzY3Njc2NzY3Njc2FwEWBwYHBgcGBwYHBgcGBwYnASY3HwE+AT8CNicBDgEPAgYFNzY3Njc2FxYHIwYHBg8BBhUGJyYTNjc2NzQmNDYyFhc+AhYXFhQHBicmJyYGBxYXPgIeARcWBxQHBgcWFx4BDgEnJicOASMuAzYfAR4CNjcmJwYHBicuATcGFhcWNjcmJwcGNyY3NjM2NzY/ATYzNhYPAQYHBgcGBxYXPgIuAiIHAx9MO5CBMTcTBgoODyMaATgaCh9NOpGBMDcUBgkOECMZ/scZRmPWGXZFioGBLv7IGHZGi4CAAT4VFhkWIQsKDAwCHxUYExQCDAsIIQIICAsJCAgHBAgYIBoLCAgFCgYMCRYMFB8OISAeHgYEAgoIDggIBAIICgQJBhIhEg8aDgISBA0JCBIQDBUjICEdFQ4MLAEEBgoYFR4TCgRvCQkCAiAVFxQTAgIMFAgWFRoVIQwIIBUGCAQEDhAOCfNhTD1USjE3QhALDAQIGP7IGyRjSj1USjE1RBALDAQIGAE4GxJj1k96KVBlZScBOE56KVBlZe4dGxoXGgkJDAwZFhcZHAICDAwKAXESDxIOAgUKCggCCBAIBgwIFAUGAgICBAIKFCUIDAQKGA0OEA8SExIGBwIKCAIECAgSDAIMEhAQAQMCDAICCxUpEQICEQwcGgcOAwoCCSATDgaHCgwCGRYXGhsEDBYMHRsaFxkKuCMVBRAQDBACBQAMAAD/aQPoA1MAFAA5AEMATQBiAIcAkQCbALAA1ADeAOgA3UAr4t+lnkdECQIIAwbe26+oQ0ATDAgFApWSV1AECg2RjmFaBAwJ2j8CBAwFR0uwJFBYQDcUAQYRAQMCBgNhEAECEwEFDQIFYAANAAoJDQpgAAkADAQJDGASCwIEDwgCAQQBXA4HAgAADABJG0BBDgcCAAYAbxQBBhEBAwIGA2EQAQITAQUNAgVgAA0ACgkNCmAACQAMBAkMYBILAgQBAQRUEgsCBAQBWA8IAgEEAUxZQCrh4N3c2NfMy7u6rKuioZSTkI+Lin59bGteXVRTRkVCQT08MTAdGRUVBRcrETQ3NTQ2HgEHFRYUBxEUBi4BJxEmNxQfAR4CFxYyNz4BNzY/ATY0JyY1JicuAScmIgcOAQcGDwEGExQWMjYnEQYiJxE2Mhc1NCYOAQcTNDcRNDYeARURFhQHFRQGLgE9ASY3FB8BHgIXFjI3PgI3NDc2NC8BLgEnJicmIgcGBwYHBg8BBhcUFjI2PQEGIicRNjIXETQmDgEVFzQ3NTQ2HgEXFRYUBxEUBi4BNxEmNxQfARYXHgEXFjI3PgI3NDc2NC8BLgInJiIHDgEHBg8BBhMUFjI2NxEGIicRNjIXNTQmDgEXPzZOOAE/PzZQNAE/PwMCBBAYDRAeEQ0YBwgEAgQEAgQIBxgNECAPDhUKCAQCAz4SGhQBECAPEB4REhwQAds+OEw4Pj44TDg+PgQCBBAWDw8gDw4XEAQCBAQCBBALDA4PIA8ODAkKCAQCBD8SGhIPIA8PIA8SGhLbPjZQNAE/PzZOOAE+PgQCBAgHGA0QIA8OFxAEAgMDAgQQFw4QHhENGAcIBAIEPhIcEAEQHhEQIA8SGhQBAhpMMF4nOAI0KV4wmDH+Kyc4AjQpAdUwTQwOBg0WEgMGBgQRDAoNBg4YDQQCDQoMEgMGBgQRDAoNBg79ow4SEg4BuQQEATEEBEIOEgIOEP2vTDEB1Cc4AjQp/iwxmDFeJzgCNCleME0MDgYNFhIDBgYEERYNAgQOGA0GDRYICgMGBgMKCAwKDQYO5g4SEg5CBAQBMQQEAbkOEgIOENpMMF4nOAI0KV4wmDH+Kyc4AjQpAdUwTQwOBg0KDBIDBgYEERYNAgQOGA0GDRYRBAYGBBEMCg0GDv2jDhISDgG5BAQBMQQEQg4SAg4QAAAGAAD/agPoA1IAWwCnALAAuQDCAMsBC0Aln56Lih4RBgkAKAcCEA+ngoFcBBITVjUCDhF5eGVkTD8GAwYFR0uwIVBYQFQCAQAKCQoACW0LAQkMCgkMawgBBg0DDQYDbQUBAwcNAwdrAAwADxAMD2AAEAATEhATYAASABEOEhFgAA4ADQYODWAABwAEBwRcAAoKAVgAAQEMCkkbQFoCAQAKCQoACW0LAQkMCgkMawgBBg0DDQYDbQUBAwcNAwdrAAEACgABCl4ADAAPEAwPYAAQABMSEBNgABIAEQ4SEWAADgANBg4NYAAHBAQHUgAHBwRYAAQHBExZQCjKycbFwcC9vLi3tLOvrquqnJuVlI6NdnVvbmhnUE5HRD07JzctFAUXKxE1NDY/ATY3JyY2PwE2MzIfATY/AT4BNzMyFh8BFhc3NjMyHwEeAQ8BFh8BHgEXFRQGDwEGBxcWBg8BBiMiLwEGDwEOAQcjIiYvASYnBwYjIi8BLgE/ASYvAS4BNxcWFxYXFg8BFzc2MhcWFxYfATM3Njc2NzYyHwE3JyY3Njc2PwE1JyYnJicmPwEnBwYiJyYnJi8BIwcGBwYHBiIvAQcXFgcGBwYPARc0PgEWFAYuATcUFj4BNC4BBhc0NjIWFAYiJjcUHgE2NCYOAR4VYAUKNQ0GDzsTGhMQUBUUFAMkFVYVJAQTFBVQEBMaEzsRBA01CgZfFhwBHhVfBgo1DQQROxMaExBQFRQTBCQVVhUkAxQUFVAQExoTOw8GDTUKBWAWHD5fIwwGCA8TNz1SDyILEhEiBhNWFAUiERILIg9SPTcTDwgGDCNfXyMMBggPEzc9Ug8iCxIRIgUUVhMGIhESCyIPUj03Ew8IBgwjX9qCsoKCsoIcbqJubqJuQkhqSEhqSB84TDg4TDgBM1YVJAQTFBVQFCwQOxMLNQoGXxYcAR4VXwYKNQsTOw8uE1AVFBMEJBVWFSQDFBQVUBQsEDsTCzUKBl8WHAEcF18GCjULEzsPLhNQFRQUAyQVEwYiERIfHVI9NwoGCAYMI2BgIwwGCAYKNz1SHR8SESIGE1YUBSIREh8dUj03CgYIBgwjX18jDAYIBgo3PVIdHxIRIgUUK1qAAoSwhAKAWlBwAmykbAJwUDVISmhISDUnNgI6SjoCNgAAAAv/+P9qA+gDUwAeAC4ANwBAAFUAXgBnAHAAeQCCAIsB9UuwClBYQCF6AQ0MSCwCBA1HAQoHXygCCQFWAQYFBUdVAQ04LwIKAkYbS7ALUFhAH3oBDQxILAIEDUc4LwMBB18oAgkBVgEGBQVHVQENAUYbQCF6AQ0MSCwCBA1HAQoHXygCCQFWAQYFBUdVAQ04LwIKAkZZWUuwClBYQFAAAA8ODwAObQANDAQMDWUABAcMBAdrAAEKCQoBCW0ADgAMDQ4MYAAHAAoBBwpgAAkACAUJCGAABQAGAwUGYAADAAIDAlwADw8LWAALCwwPSRtLsAtQWEBKAAAPDg8ADm0ADQwEDA0EbQAEBwwEB2sADgAMDQ4MYAAHCgEBCQcBYAAJAAgFCQhgAAUABgMFBmAAAwACAwJcAA8PC1gACwsMD0kbS7AkUFhAUQAADw4PAA5tAA0MBAwNBG0ABAcMBAdrAAEKCQoBCW0ADgAMDQ4MYAAHAAoBBwpgAAkACAUJCGAABQAGAwUGYAADAAIDAlwADw8LWAALCwwPSRtAVwAADw4PAA5tAA0MBAwNBG0ABAcMBAdrAAEKCQoBCW0ACwAPAAsPYAAOAAwNDgxgAAcACgEHCmAACQAIBQkIYAAFAAYDBQZgAAMCAgNUAAMDAlgAAgMCTFlZWUAeiomGhYGAeHd0c29ua2pmZWJhXVxZWB0YNScZEAUZKxM2NyUmNTQ/ATYyHwEWFA8BBiMiJwMGBwYrASInASY3BhcBFjsBNjcTLgInBwYXNDYeAQ4CJjcUFj4CLgEGNxYXHgIXNxcWPwE2LwEmDwEGHwEDNDYyFg4CJjc0Nh4CDgEmNxQeATY0Jg4BATQ2HgEUDgEmFzQ+ARYOAS4BJxQeATY0Jg4BAgotAagMFysYQBjwFxcrGB8XFKgRMwgKBCUZ/nIkSAMLAY0KCwgQCJI6gqIqwg+3JjImAiI2Ih0SHBACFBgWLR4yO0RqLSk3CwotDAzyCgwtCQk31xIaFAIQHg49LEQqBDI8NCMcJhwcJhwBdyxELCxELB8SGhQCEB4OAhwmHBwmHAFiMROqFBUhGCsXF/AYQBgtFQz+Xi8KAhsBiSMmEAz+dwoEEAFzPTASDk4GKRkmAiI2IgQqFw4SAg4gDAYYhgYHBg40LGY3CwstCgzyCgotDAo2/koOEhIcEAIUmSEuAipGKgIuIRQaAh4kHgIaAeAhLgIqRioCLosOEAIUGBQCELoUGgIeJB4CGgAAAAAM////iQPoAzMAEQAjACwANQA+AEcAVwBbAGQAbQB2AHwAnkCbIwENBAFHfAEEAUYAAAAEDQAEYAANFRANVAAVFgEQFxUQYAAXAAMTFwNgABMAFA8TFGAADxEOD1IAERIBDgsRDmAACwAMCQsMYAAJAAoHCQpgAAcACAUHCGAABQAGAgUGYAACAQECVAACAgFYAAECAUx7eXZzcm9tamlmZGFgXVtaWVhWVE5MR0RDQD47OjcxMjE0IyM0NzMYBR0rFRE0NjchMh8BFhURFAYHISImNxQWNyEyNicRIyImPQEhIgYXEzQzITIUJyEiNTQzITIUIyEiNTQzITIUByEiNTQzITIUJyEiPQE0NhczMhYXFRQGJyMiJjczNSMFNDMhMhQnISI1NDsBMhQrASI1NDsBMhQHIyIlFBY3Myc2KAKQGRS7EjYo/NQnOEAQDwMsDhIBfCg2/Y8OEgE+EALOEBD9MhAQAs4QEP0yEBACzhAQ/TIQEALOEBD9MhASDdsOEAESDdsNEj+cnAEZDwF3EBD+iQ8PnQ8PnQ8PnQ8PnQ8BGSYYfbsZAu4nNgESuxQZ/a4nNgE4Jg4SARAPAjM2J30SDf1gECABbRAgbg8eAW0QIAF9uw4SARAPuw4SARAufawQIAFtECBuDx4BHxkmAbsAAAf////IA+gC9AAmADYAVgBfAGgAegB/AI5AizYBAQl9aQIIFkoBCgtXAQIKBEcNAQsHCgcLCm0AAAAJAQAJYAABAA8TAQ9gABMAFggTFl4AFAcIFFQVAQgQAQcLCAdgDgwCCgYEAgIRCgJgEgERAwMRVBIBEREDWQUBAxEDTX9+fHt5dm9sY2JaWVZUUU9IRkRDQUA+PTs5NDE0EyISEhInIzMXBR0rGQE0NjMhMhYdATMyHwEWHQEUBisBDgEiJicjDgEiJicjIiY9ASImNxQWNyEyNjURNCYjISIGFxMUFjsBPgIWFzM+AhYXMzI2JzU0LwEmKwEVFAYnIRcUHgE2LgEOAQUUHgE2NCYOAT0BNDY3MzIfARYdARQGKwEiJjczNScjNigB1Sc2fTMbfRA2KCMMQlZCDKQMQlZCDCMoNic4QBAPAdUNEhIN/isOEgFdEg4jC0RURAukDEJWQgwjDhIBBX0IEn02J/5pfSYyJgIiNiIBlSQ0JCQ0JBAPHxIHXgYSDX0OEiB9Xh8BPwFXKDY2KD4puxgdvCc2KjQ0Kio0NCo2J142KA4SARAPAVcOEhIO/e0NEik0AjgnKTQCOCcSDbwKB7wO2yc4AZwaJAIoMCgEIBwaJAIoMCgEIL+7DhABDY0ICi4OEhIOLo0AAAAABgAA//gEeALEAAMACQAfACYALgBBATi1NwEKAgFHS7ATUFhAUAAADQENAAFtAAEMBwFjAAUICQQFZQANAAwHDQxgAAcPAQIKBwJhAAsACgMLCmAAAwAIBQMIXhABBA4GBFQACQAOBgkOYBABBAQGWQAGBAZNG0uwFFBYQFEAAA0BDQABbQABDAcBYwAFCAkIBQltAA0ADAcNDGAABw8BAgoHAmEACwAKAwsKYAADAAgFAwheEAEEDgYEVAAJAA4GCQ5gEAEEBAZZAAYEBk0bQFIAAA0BDQABbQABDA0BDGsABQgJCAUJbQANAAwHDQxgAAcPAQIKBwJhAAsACgMLCmAAAwAIBQMIXhABBA4GBFQACQAOBgkOYBABBAQGWQAGBAZNWVlAJwsKBQRBPzEvLiwpJyYkIiAdHBcVEQ8ODQofCx8IBwQJBQkREBEFFisBIRUhByIGBzMmAzI2NzMGIyImNzQ2MzIeAQcUByEUFiUzMjU0KwE1MzI2NzQrASchMh4CFRQHHgEXFA4DJyEEB/7jAR2MMz4D4wpcI0IJeze3d44BkHRNcjoBAf6RQP1UpXJvqJwsMgFqkZsBTDBMQiJgQEABHC5ARij+qwKVRak6M23+uiQeq5J5dJpMfE0JET5EHV1kaioqUHgQJEgyZS4RXkMpRi4gEAEAAAUAAP+WAxIDMwAKABUAKQBCAGQAIkAfVj88IAAFAUUAAQAAAVQAAQEAWAAAAQBMPj0yMQIFFCsBFgYnLgE2NzYeARcuAQcOARceAT4BEy4BLwEmBw4CBx4BHwEWPwE+ARMOAwcOASYnLgMnJic/ARYgNx4BBhMGAw4CBwYnJicuAi8CLgEnPgM/ATY3NhcWFxYUAccEQB8VEA4WFCoePghuNyMqAQNSZkR/CygMKKKaGBoiCxA0DzF/ezIPMjEECgQcEzB0bDsZKC4kCw4RAwp8AT58DAIIZQ8vAxgYE4zIi1EIDAgBBh8GDgUCEBIiCBtGadOmViIJAXMjLBMJLi4JCwggCjxAGQ9EJjNICVYBYQ8UAgcaGwQGEg8QFAIGEA8HAhT9zg44JigMGxoCCQUKFB4TNm0JBVNTAxQeAhNe/vARHBIIRhUPPwYQGAcqrSJiJw4aEBIDChoKFTEZKwsiAAAABAAA/7EEdwMLABkANQBXAFsA7EuwEFBYQDwJAQMEAAQDZQYBAAUFAGMQAQ8ADAIPDGAIAQIKAQQDAgRgCwEFBwEBDQUBYQANDg4NVAANDQ5WAA4NDkobS7ARUFhAPQkBAwQABANlBgEABQQABWsQAQ8ADAIPDGAIAQIKAQQDAgRgCwEFBwEBDQUBYQANDg4NVAANDQ5WAA4NDkobQD4JAQMEAAQDAG0GAQAFBAAFaxABDwAMAg8MYAgBAgoBBAMCBGALAQUHAQENBQFhAA0ODg1UAA0NDlYADg0OSllZQB5YWFhbWFtaWVFPPz00MiwqKCckIhEmIhIjIhARBR0rATMOAQciJjQ2NzIWFyMuAQciBgcUHgIzMiUzDgEHIiY3NDY3MhYXIy4BByIGFxQeAjMyNjc0JicmLwEmISAPAQ4BBw4CFhceAhceATMgPwE2Nz4BExEhEQG2dAheSVpoaE5TXgdxAyIdICIBBg4eFjUBlXMHXklaaAFoTlJeB3ICIhwgJAEEEBwXGyDLEhkDBBUw/qv+oy8KBwoDGRABEhgECgwEGNqaAVQxFQYBGhBs+4kBIFlkAYLcggFiWSQoAURBGigmFE5ZZAGCb22CAWJZJCgBREEaKCYUKmZzcCIFAw4kJAYECAQhcOhwIQUIBgQSEiQOBAUhcAId/KYDWgAIAAD/agPoA1IAAwAGAAoADgASABUAGQAtAERAGhkYFxUUEhEQDg0MCgkIBwYFBAMCARUAAQFHS7AkUFhACwAAAQBwAAEBDAFJG0AJAAEAAW8AAABmWbYqKSAfAgUUKzcFNScHNycBJScHJzcnByc3NQ0BFzUHNyUVBREUBwEGIicBJjURNDcBNjIXARZ5AVC6uWxsAckBUZe6K5iYmE26/rACrWy5l/6vAckT/jcMGAz+NxMTAckMGAwByRPG4cl8FEhI/j/hZHxKZmZmNHzJ4ZhIkBRk4ckY/tAXDf7PBwcBMQ0XATAXDQExBwf+zw0AAAAAAQAA/44D4QMLAA8AL0AsCAcEAwQBRAABAgFwAAAABAMABF4AAwICA1IAAwMCVgACAwJKEREUFBAFBRkrEyEDBSU3MwcXJTchNyE3IZoDR5T+P/57J6YQ6wEQJv1dIQKiFv1eAwv9GJWVxlJZWb6lawAAAAACAAD/sQNZAwsADQAdADNAMAAAAQIBAAJtAAIDAQIDawAFAAEABQFgAAMEBANUAAMDBFgABAMETDU1IRMhEQYFGislESERISIGFxEhESEyNhMRFAYHISImNRE0NjchMhYDNf54/vQ0SgEBiQELNEojXkP96UNeXkMCF0NeUgEMAYlKM/70/ndKAkv96EJeAWBBAhhCXgFgAAgAAAAABHcCtQAFAAkADQARABkAHQAlACkAikCHFwEIAAhvAAAHAG8ABQELAQULbQAHFgEGAgcGXg8JAgITDQIDBAIDXhkUGA4VBQQSDAIBBQQBXhEBCwoKC1IRAQsLClYQAQoLCkomJhoaDg4KCgYGJikmKSgnJSQjIiEgHx4aHRodHBsZGBcWFRQTEg4RDhEQDwoNCg0MCwYJBgkSEREQGgUYKxMzESERMxE1IxUTETMRJxUzNRchESE1MzUjNzUjFRMhESE1MzUjNzUjFbdy/te3ReVycnIuASn+17e3t0XlASn+17e3t0UCtf3bAYX+187OASn+ewGFoHJyoP3yWy5czs4BKf3yWy5czs4ACP/9/7EDXwMLAA4AHwAmAC0AMAA8AFQAYQBoQGVHPzc1IgUCAxEBBAJLAQUEPSspFwsCBgAGBEcABAIFAgQFbQAFAQIFAWsABgEAAQYAbQAIAAMCCANgAAIAAQYCAWAAAAcHAFQAAAAHWAAHAAdMX15ZWFNSUVBPTTQyJiUULAkFFislJicjBw4EBycWMzIDJicGIxUUFhc+Az8BPgEnJicOAQcyBSYHFhc+AQEiMAUmIyIHFhc+AzcTJicHBg8BDgIHHwEWFzc2FjIeAjIfARQOASIuAj4BMh4BAjsXNwEBCR5SSEoUCWeDSSILEq7KMC0cUk5EFRUCCjlDRk1qE6kCJ3VvMRY+VP5KAQFKZ4orLElAJ0QoIAWEAlEBBQYYEixCKRkDAgMpFSgmICAWEgVEcsboyG4Gerz0un4NhpABAwwqMk4rBlQBcBsjNAxFfjExWDIoBwcBAnh3XCSIVIUhEYWBKoAB6lFbCl93DyYeIgb++4FkAQcGGRMeKg81CgYDBAICBAIGAwV1xHR0xOrEdHTEAAAAAQAA/7ECOwNSABMAYEAKAAEEBQoBAgECR0uwJFBYQBsAAgECcAAEAAMABANeAAAAAQIAAV4ABQUMBUkbQCIABQQFbwACAQJwAAQAAwAEA14AAAEBAFIAAAABVgABAAFKWUAJExETExESBgUaKwEDFzMVIQ8CIzUTJyM1IT8CMwI7qQ6b/uYZTxGoqQ2cARsZTxGnAqn+uxHoEJkRqgFFEecRmBEAAAAABQAA/7EDxAMQAAMAEwAXABsAHwAPQAweHBoYFhQPBwIABS0rEwUHJQUVBRU1BzUlNRc3NRc1FRcBFwUnBRcFJxMFByXgARS//u8C4/7uAf7vUr8BwP6Av/7svALkvP7vv78BEbz+7AHIq5+ynjykAQEBAaQ8Np8BAQEBnwK0n6mWlpiynwHzspapAAAEAAD/cgNZA0gAFgA1AFsAgACrQA5WAQcDNAEABwJHdAEGRUuwC1BYQDwABgQGbwAEBQRvAAUIBW8AAwIHAgMHbQAHAAEHYwAAAQIAAWsACAACAwgCYAABCQkBVAABAQlZAAkBCU0bQD0ABgQGbwAEBQRvAAUIBW8AAwIHAgMHbQAHAAIHAGsAAAECAAFrAAgAAgMIAmAAAQkJAVQAAQEJWQAJAQlNWUAUYWBSUU1LRUM/PTs6Li0qGSQKBRcrBSYHDgEHIicmIgcGFBceATI3PgI3NicmJyYjIgcGBwYXFjY3PgEyNjI2FjYXMh4BFx4BNzY3NC4CIg4BJwYuAwciBgcGFx4BNzI+AhceAzcWNjc+ATcUDgIuAyc0PgU/AT4BNz4BNxYXHgEXHgYCiwMKEUApSCMDCwgEBBM8NhwXMBgEBxgLCw0eGg0QHA4HBggOAggEBggGCggIDxIIBAUEBQ3BBgwaI0hIFA8qKjQ6IUBcAQEqECYnIFJEQhMPKiYmDBQaEg8SHER2mKyceEYBFiAwJjIWDTsLIBEUGgNIIBlgGAwULigsIBQjCwgNEgEcAgcDDAUSDgICFAwGBkoaCAkGBxgOCwQECwEICAYCBgMICAgKAgEHqQwaGBAuMAEBGB4iFgFYNz8dCwoBJComAgEiKCQBAhIaF0RyW55oQAQ8dJpbMlxIPCwiEgUeBhYODzItVhYQLA4IDCgoQkZgAAAAAAEAAP+xAhcDUgAUAFm1AAEABgFHS7AkUFhAGgADAgNwBQEBBAECAwECXgAAAAZYAAYGDABJG0AgAAMCA3AABgAAAQYAYAUBAQICAVIFAQEBAlYEAQIBAkpZQAojERERERMhBwUbKwEVIyIGHQEzByMRIxEjNTM1NDYzMgIXVzAipBaOq46OdGFSA0uTKChqpf5YAailemhyAAAAAAMAAP+xA1kDCwAPABgAIQAsQCkGAQACAG8EAQIDAm8FAQMBA28AAQFmAQAgHxwbFxYTEgkGAA8BDgcFFCsBMhYVERQGByEiJjURNDY3EzQmDgIeATYlNCYOARQeATYCuENeXkP96UNeXkPlRmJEAkheSgE4RGRERGREAwtgQf3oQl4BYEECGEJeAf5TMUYCQmZCAkYxMUYCQmZCAkYAAAADAAD/sAK5A1MAIwA+AEMAYUAOCAEDAEABBAECRwkBBERLsCRQWEAaAAMAAgEDAmAAAQAEAQRcAAAABVgABQUMAEkbQCAABQAAAwUAYAADAAIBAwJgAAEEBAFUAAEBBFgABAEETFlACTsrNSc4JAYFGisBNzYmJyEiBhcRFD8BPgE7ATI2NzY3NiYHIyImJzU0NhczMjY3DgIHDgQrASIGAw4BJyY1ETQ2FyEyFgcDNz4BAi4VAxAM/nMNEgEDog0SEYYMEAMNBwIQDaQQFAEWD8EKFIAJKiQBBAIODhwTlwcK6QwqBh4qLgHvNSQMWBMRLAJgbA0SARQK/ZkEBMQPCBAJSCIMFgEWEBcQFgEOhinYrgoMDBgOCgv+8g4EBQwqAxMfNgE8Ov5HYVjWAAAABgAA/2oDwgNSAAYADwA7AEcAawB0AVhAGFlSExEEAwpIMQIPA0ksAgcPA0cQAQUBRkuwDlBYQFQADBEQCAxlAAYIAggGAm0AAwoPCgMPbQAHDwkPBwltAAAJAQkAAW0ABQACCgUCYA0LAggOAQoDCAphAA8ACQAPCWAAAQAEAQRcABAQEVgAEREMEEkbS7AhUFhAVQAMERARDBBtAAYIAggGAm0AAwoPCgMPbQAHDwkPBwltAAAJAQkAAW0ABQACCgUCYA0LAggOAQoDCAphAA8ACQAPCWAAAQAEAQRcABAQEVgAEREMEEkbQFsADBEQEQwQbQAGCAIIBgJtAAMKDwoDD20ABw8JDwcJbQAACQEJAAFtABEAEAUREGAABQACCgUCYA0LAggOAQoDCAphAA8ACQAPCWAAAQQEAVQAAQEEWAAEAQRMWVlAI3Nyb25raWdjYmFfXltaWFdMSkNCPTw7Ojk3JiQiIyEhEgUYKyU0IyIUMzIDNCYnIhUUMzITFQYHFhUUBgcOARUUHgUXFCMiLgI1NDc1JjU0NzUuASc0NhcyFzITIzY1ETQnMwYVERQlFQYjIi4DPQEzNSMiJyIHNTM1NCczBhUzFSImKwEVFDMyARQGLgI+ARYBTFxYYFQhIiBFRUKWFBgJUkUWFhomMi4qFgLLJkQ+JGYmIyg0AWpONi429XwCAnwDAVIoOSMyHBAEAQsHAwwVNgR/A18IIAgvMCL+2ixALAEsQioFOHMB4SIsAVFLAQFwBwYYF0ZkDQUUFxEWDgoUFjAfqg4gPClcIQMWMD0PAw1eLk1oARr+LxkxAVQ1ExMy/qkxY24WGB46LCTEAgEDaioeFBdFagLMSQIjIDIBMEIwATIAAAAABAAA/7EDoQLDAAwAGQAzAFoAS0BIWVJORwQCCA0AAgADAkcJAQcIB28ACAIIbwQBAgMCbwADAANvAQEABQBvAAUGBgVUAAUFBlgABgUGTFVUIx1LNyISKxwTCgUdKyUUDgEuAz4CHgEFFA4BLgM+Ah4BFzQmIyIHBiInJiMiBgcUHgM3MzI+AzcUBw4EByIuBCcmNTQ3JjU0NzIWFzYzMhc+ATcWFRQHFgFlDiIuJAwCECAyHhIBYw4iLiQMAhAgMh4SWE5BF1YoYCdVGEJMASQ2UkouXi5KUjgifiIWSlRqVjIrSFxOTDoTI0wPHD1aPVJaU0o6XDsdD0yrFi4oAiQyKDQiBCosGBYuKAIkMig0IgQqLBhDXgwGBgxeQzFILBYMAggaKEySdEUrPiIUBAEEChgiOCRFdIRZLTJAOSwvFBIuKgE5QDEtWQAC//3/sQNfAwsAFAAhAChAJQABAAMAAQNtAAMDbgAEAAAEVAAEBABYAgEABABMFRkTExYFBRkrJRM+ASYnJiIGBwYiJy4CBw4BFhcFFA4BIi4CPgEyHgEBr8QJCA4bFzAiDRRDFA0iMBcaEAoJAmxyxujIbgZ6vPS6fnsBCA0oOBAOFA8WFhASAg8RNioMJXXEdHTE6sR0dMQAAAAB////sQNIAwsAIwA2QDMSAQMCEwEAAwJHAAIAAwACA2AAAAAFBAAFXgAEAQEEVAAEBAFYAAEEAUwVJSMnJRAGBRorASEWFRQOASMiLgM+AjMyFwcmIyIOARQeATMyPgM3IwGtAZQHZrx5WJ50QgJGcKJWp3h1RGZIekhIekgwUjQoEAXzAZslInm+bERyoK6gckRxcENKepZ6ShwmNiwVAAAAAAIAAP/EBQYC9wAjAC8AXUBaDwECARABCgICRwAKAgUCCgVtAAcEAwQHA20AAQACCgECYAgBBgQFBlIMCwkDBQAEBwUEXgADAAADVAADAwBYAAADAEwkJCQvJC8uLSwrERETERUlIycjDQUdKwEUDgEnIi4CND4CMzIXByYjIg4BFB4BMzI+AzcjNSEWJRUjFSM1IzUzNTMVAyJisnVTmG5AQG6YU6Byb0FiRXRERHRFLk4yJhAE6AGCBwHkdXV1dXUBVXW0aAFAbpimmG5Aa2s/RHiMeEQaJjAuEo0kJHZ0dHZ0dAAAAAAEAAD/agPoA1IACgASABkAKABwQA8RAQADDw0CAQAcAQIBA0dLsCRQWEAiBgEDBAAEAwBtBQEAAQQAAWsAAQIEAQJrAAICbgAEBAwESRtAGgAEAwRvBgEDAANvBQEAAQBvAAECAW8AAgJmWUAVExMBACUiExkTGRcWBQQACgEKBwUUKxMyFxYXIyYnJjY3BQYHJic2NxY3FhIXIwIJARQHAgMmJyY2OwEyFhcW9hILlTX5R4YGCgsCCBsrLGMXAnZ9g6gT/Bf+4wJ1OCajDi0CCgrIDBIEQAHbDszk9qwJEgHHb2ytnnuAvt60/l7fAXMBwv6/7dgBOAEkqJ4JDg4M5AAAAAIAAP+xA1kDCwALABsALEApCQUAAwIAAUcABAEBAAIEAF4AAgMDAlIAAgIDWAADAgNMNTQSFREFBRkrARMjBwYHLwEjExUzAREUBgchIiY1ETQ2NyEyFgHElD9XDgsXV0OTOQGVXkP96UNeXkMCF0NeASIBFq4bGDOu/u21Afr96EJeAWBBAhhCXgFgAAAAAAIAAP+OAxIDCwAQABUAOUA2FAsGAwJEAAUAAAQFAF4GAQQAAwEEA14AAQICAVIAAQECVgACAQJKAAASEQAQABAVFBERBwUYKwE3IRMhDwEvASMfATM3EyEnAyEDBSUCdwn+EhoBVgxubgdhDMoCyBz+mQj/AxJI/r7+vwIFYv7WgB0dTps3NwEwZQEG/N1aWgAAAAAFAAD/sQNZAwsACAARABoAVABtAGNAYBIBAwUBRwAKAgcHCmUADQsOAgYFDQZgAAUABAAFBGAAAwAAAQMAYAABAAIKAQJgCQgCBwwMB1QJCAIHBwxZAAwHDE0gG2plXllSUT08Ojk4NzY1G1QgUxMUExQTEg8FGisBNCYiDgEWMjY3FAYuAT4CFjcUBiIuATYyFiUiKwEiDgEHDgEHDgIWBhYGFhQfAR4BFx4BMhY2FjYWPgE3PgE3PgImNiY2JjQvAS4BJy4BIiYGARQHDgEHBiInLgEnJhA3PgE3NiAXHgEXFgI7UnhSAlZ0VkuAtoICfrp8Px4sHAIgKCL+5gQnOxRELhEcKgwGCAQCAgICAgYKDCocEDBCKkwKSixANA0cLAoGCAQCAgICAgYKCyodEC5GJlABqgMFgHMy/jJ0gAUDAwWAdDEBADF0fgYDAV47VFR2VFQ7W4ICfrp+AoKKFR4eKh4eZgQGCAsqHBAwRCZQBlAmRBgoHCoLBgoEBAQEBAgCCgsqHBAwRCZQBlAmRBgoHCoLBgoEBP6igDF0gAUDAwZ+dTEBADF0gAUDAwZ+dTEAAwAA/7MEdwNOAAwALABPAIZLsBpQWEAuDQEDCAECAQMCYAABAAAFAQBgCwEFCgEGBwUGYAAHAAkHCVwABAQMWAAMDAwESRtANAAMAAQDDARgDQEDCAECAQMCYAABAAAFAQBgCwEFCgEGBwUGYAAHCQkHVAAHBwlYAAkHCUxZQBZOTEpIQkA9Ozk3JiIjJRIjJDMyDgUdKwEUBiMhIiY0NjMhMhYXNCchIiY0NjMhLgEiDgEXFBchMhYOASMhHgEzMj4CNxQGKwEWFRQOAiciJicjIiY0NjsBJjU0PgI3MhYXMzIWAzAaFv55FBwcFAGHFRx3Df3cFBwcFAH7MaTEqGIBDAIkFRwBGhb+BjGkYUqGYjrPHBRJCUh8ql2J4jdqFBwcFEoKSnqqXoniN2kUHAGCFBwcKBwcFDAvHCccUF5iqGIwLxwoHE9eOmCI2BMcMC9drHhOA5R5HCgcLzBdqnxIAZZ4HAAABAAA/7ADWQMLABsANgBSAG4ASUBGaTQdAwIDY2JbWlZQS0pCKyYlHhsTEg4RAQJBPQUDAAEDRwcBAwIDbwYBAgECbwUBAQABbwQBAABmbWtgXxknLxgeJwgFGislDwEOAScOASciJic0NjcmNj8BFwcGFBYyPwIDFwcnJiIOAR8BBy8BLgE3LgE1NDYzMhYXNhYBFAYjIiYnBiYvATcXFjI2NC8CNx8BHgEHHgEDFAYHFgYPASc3NjQmIg8BJz8CPgEXPgE3MhYCVVllJGIuCUAoL0IBMiYMGiQHVAYVKToVZVpqB1UHFTooAha+VFplJhgOJzJELypABy9eAedCMClACDBoJgZUBxQ6KhURrlWuECQaDCs4ATgrDholBlUHFSo6FL9VWlUQJWgvBkAsL0T7WWYjGgwnNAFELyk+CTBiIwdVBhU6KRRmWQEoB1UHFSo6Fb5VWWYlaDAIQCgvRDgoCxr9iC9ENicQGCYHVQcUKDwUEK5VrhEjYi4GQgJKK0IFMGYlB1UHFDoqFb9VWVURJRoPKjgBRAAAAAIAAP/5BHgDBwAbAFIAU0BQFAACBwE7AQUHPyQCBAUhAQMEBEcAAgECbwABBwFvCgEHBQdvCAEFCQEEAwUEYAYBAwAAA1QGAQMDAFgAAAMATFFPSEYmJCYjJSYjKTULBR0rAR4BBxQGIyEuATU0NjcmNTQ2NzIXPgEXMh4BBwUUFjMyNycmJwYjIi4BNjMyHgUXMjYnNCYnIgcXHgEXNjMyFgcUBiMiJi8CLgIHIgYD7T1OAYRd/U1fhD4zB1xBNSsqpGRdnFwB/RheRU05GhEIJSsfKgEsHRguJCQoLkAjRF4BXkRQNxEJFAYlKh0uASofGCwSJScULj4jRF4BoxlwRFuCBoBdPWgeFhhAWgEhVmoBWppbqERQOB8UCCQmOyYYJDAsKBQCUEJETgE2EwoaBSMkHSAmFhQqLhgiHAJOAAAAAAEAAP/5A+gCZgBgADRAMVkmJQAEAgEBRwYBBAcBAQIEAWAFAQIAAAJUBQECAgBYAwEAAgBMLC8pJyglLCsIBRwrARQXHgMXFhUUBiMiLgUvAS4DIyIOARUUFjMyNzY3FwYHMQYjIi4BJzQ+AjMyHgYXFjMyNjU0LgYnJjU0NhceARcxHgIXByYnMSYjIgYC0QYFEhoYE7V2UyE6LCocIBAOFBIiMEQtNWI4dlhjLR8PLwgQSY9SikoBMFJuOzFQOjAgIhYiDjVNLUAWIi4wMigiBAJiPiswGgYODgRIDw8NKhsmAckDFBAWEAYHModRbBQgMjBELiU1LToyFj5kNVmGNSQdVRMUVViQUTtwVDQWIjY6SEJQH3A2LRggFBAOGCI4KQkJPloBAgwYBhAYAzcbDAwkAAAAAAkAAP9oA1YDUwAHAA4AIAD/AQwBGwEnATsB3wOHS7AKUFhBKwEcAQkAdABqAF8AWAANAAsABwAJAAYAAwEZAJsAAgAFAAQAvwAwACMAAwAAAAUAIQABAAgAAAHZAW4AAgAQAAgA9gDaAAIABwAOAN4AAQALAAcABwBHG0uwC1BYQSsBHAEJAHQAagBfAFgADQALAAcACQAEAAMBGQCbAAIABQAEAL8AMAAjAAMAAAAFACEAAQAIAAAB2QFuAAIAEAAIAPYA2gACAAcADgDeAAEACwAHAAcARxtBKwEcAQkAdABqAF8AWAANAAsABwAJAAYAAwEZAJsAAgAFAAQAvwAwACMAAwAAAAUAIQABAAgAAAHZAW4AAgAQAAgA9gDaAAIABwAOAN4AAQALAAcABwBHWVlLsAlQWEBkAAkPAQ8JAW0AAwEGAQMGbQAGBAEGBGsABAUBBAVrAAUAAQUAawAACAEACGsACBABCBBrABAOARAOawAOBwEOB2sABwsBBwtrDAELEQELEWsAEQ0BChEKXAIBAQEPWAAPDwwBSRtLsApQWEBqAAkPAQ8JAW0AAgEDAQIDbQADBgEDBmsABgQBBgRrAAQFAQQFawAFAAEFAGsAAAgBAAhrAAgQAQgQawAQDgEQDmsADgcBDgdrAAcLAQcLawwBCxEBCxFrABENAQoRClwAAQEPWAAPDwwBSRtLsAtQWEBeAAkPAQ8JAW0AAwEEAQMEbQYBBAUBBAVrAAUAAQUAawAACAEACGsACBABCBBrABAOARAOawAOBwEOB2sABwsBBwtrDAELEQELEWsAEQ0BChEKXAIBAQEPWAAPDwwBSRtLsCRQWEBkAAkPAQ8JAW0AAwEGAQMGbQAGBAEGBGsABAUBBAVrAAUAAQUAawAACAEACGsACBABCBBrABAOARAOawAOBwEOB2sABwsBBwtrDAELEQELEWsAEQ0BChEKXAIBAQEPWAAPDwwBSRtAagAJDwEPCQFtAAMBBgEDBm0ABgQBBgRrAAQFAQQFawAFAAEFAGsAAAgBAAhrAAgQAQgQawAQDgEQDmsADgcBDgdrAAcLAQcLawwBCxEBCxFrAA8CAQEDDwFgABEKChFUABERClgNAQoRCkxZWVlZQScBzAHLAbwBuwGnAaUBcwFyAVkBWAFVAVQBUwFQAUsBSgEuAS0A/AD7APMA8gCmAKQAoACfAIgAhwB4AHcAaABnAF4AXQA2ADUAEgAFABQrAQ4BIwY1NDcXBiYHNhcWByIOAxcyNjc0NjQyJzUnJgU0Jzc+AiY2JjQmJy4BJxYXFgcGBwYuAScuAS8BLgEnLgQ2JicuAzY3NhYHBhY3Nj0BLgIvAQYXFCMuAQY1NCYiBgcUHgE3PgEHIiYnNDYXMh4BBw4CFQ4BFx4DFxY3PgE/ATY3NhceAQYHBg8BDgEnJhQXFjM+AT8BNhYVFA8BBg8BDgEPAQ4CJicmBwYVFA4CFw4BBwYUBwYnJicmNzYjBwYXFh8BFh8BHgEGBx4CFzYnLgEvAT4BFxY3Njc2FgcUBwYWMz4BNTYuATc2MzQ2FgE2JiMmFRYzMgcGMzIXLgYGIwYWFzI2JzQuAQciHwEWFxQ/ATQuAScmIgYWDgEUFj8BNjc0MjYBHgEGFA4CIgYnDgEHDgEnLgMnIyIHIg4CLgEvAS4CJyY2NzYuATY3PgE3PgE3FgcGJyYHBh8BHgEUFgYWFxYfAR4CNz4CJi8BJicmBwYnJjU+Aj8BNj8BNjc2NyYnJjY3NjM2FhceAQcGFxYXHgEXFg4BBw4DIy4CLwEmNyYOARcWBwYWNjc+ATc+AS4BJy4BNjceBQFyBgYBAwo3AwgGDgQCxwMCAgQIBAIKAgICAQEBAd0fBAICAgICBgQCBSoTDRMwEgYWEQgCBQUMBQkEBgEIEhAKBgwIFAkgCAQMDhUQBgYKDAcDCgwHDzwKAQUWEBIfEAIEDAIGBQYECAIKDgoKAgIMChYHBAYIDAYQCxseARgHEQoCBQYCAgQICxQZGR0eBQoOFwoUCjEFCgECAQIFAwQDBg8sIBcXDAIBEBAICg0sBAEDBAwSAgEDAgMCFBoDCw0LLzQJAhIQBBgGARoWAggBAQIKBhpDShkNDAENBQQMAQ4BCAIOCRQmKv6uAgYDBQEBBgIBBgHqAQQMBQQEAgICBxYLBQZkBgYCCAQCCAIFHwIIAggKBAQDBgQCBgQFCgYBPQsOAhIIGggcARU2Dwk6FQoMBhQQaBULGSgUHCBcIzkKGAwEBRIBAQYGAgUHMAoRDAEMHhIcEwUHCgQDBAESAhMMIzgNOCQNGBgCCgYLQxsmGQYDAQEKEAUOCgcRCgs+CAcCARwtFiQeOhUgJgIDExM4HjIIBQQKBgUQDiASCg4MAQcGAQwWCAgLCwUeNBUhIikeGgYWERMSAgcBCAgOCg4CbQEKAQMHAggBCgMGBwPwBAoGCQIIBgIEBAICAQHICg4PBxAIEAYSBhYDGz4LCyRaQRYBAhhGGRUiCA4GBAIjLhAWFyQSBQIQAhwcAQIkDwoKBQISFREWDAIEBEYJBQICBB8mIBEIGBIBAgsBEAsMEgEYFAIJDgwBCBACBAwKBAIBCQEGAwcEBggDAgYIAQMJCwsFBAEECA0BBgUaAwQEAQEDAgECAQQBAggiDg0jEQUCBA4iHCYQA14gCjgFDgwRJA8QCgMkOAcJCw0mKgkaFgIIIB4YDSYFCAMDAwYFHQkJKBUIGg0mDRAKQhEMOjIOChUSBgHECRABBQMJC2wEBAIEBgIGAgkeAwp9BgoEAQQBAg8CA4QBBAIDCAgGBwYEBQIFAwIBAv0WBg4OChAEEhICCygQCQQKBRAOCAECEBIOASIHCgIICAcMMgUJHBIYAwYEBAoUEikSCwMBBwgYCgcGDA8mEQUEBwsDEggCAxgeJAsUah0qEwUNCQwQGhoLKBwPIxQKTx0/bjNEGAwBEBAXWCc1Qj87IXQwHCgUAwESFhABBAwCDAoBFAguHydGJCgCExwSDwoUFAwHBiomCBIcEgwKBAADAAD/zANZAv8AAwAOACoASkBHIgEFAQFHBwkCAQgFCAEFbQYEAgAFAHAAAwACCAMCYAAIAQUIVAAICAVYAAUIBUwAACknISAcGxYUERANDAkGAAMAAxEKBRUrExEjETcUBisBIiY0NjIWAREjETQmIyIGBwYVESM2PQEnMxUjPgM3MhbDuMQ6LgEuODpcOAKLty4wIy4NBrgBAbgBCxgmPCJfdAH1/dcCKaspNjZSNjb+QP7DASg7QiYdERz+y9+KpRtQEhogEAF+AAABAAD/+QPaAsMAFQApQCYOAQEBRgQCAgABAHAABQEBBVQABQUBWAMBAQUBTCIREREjEQYFGisBAyMTNiYrAQMjEyMDIxMnITIWFx4BA85cumMIHx9fcrpyoHK6clUCyDhiIiEYAaP+VgHQHyX97AIU/ewCFLYsKihsAAAABAAA/7EDWQMLAA8APgBTAGMAWEBVFwEBAgABAAFOAQQAA0cADQINbwkDAgIBAm8LCAYDBAAKAAQKbQcFAgEAAAQBAGAACgwMClQACgoMWAAMCgxMYl9aV1JPTElFQjQlNCU0MjUmJA4FHSsBFRQGJyMiJj0BNDY3MzIWBTU0JisBIgcmKwEiBh0BFDsBMj0BNDY3MzIWHQEUOwEyPQE0NjczMhYdARQ7ATIlNTQmKwEiBhcVFDsBMj0BFjsBMjYTERQGIyEiJjURNDYzITIWAtwQDXENEBANcQ4O/u8kHkomDxAmSR0kCx8MEA01DRALHwwQDTYNEAweDAFJJh2THSYBDB8LEiNqHiRHTDX9qjZMTDYCVjVMAXw/DhABDg8/Dg4BEI2LHiQdHSQeiwwMgA4OARANgAwMgA4OARANgAxBVh4kJB7kDAxkFyQBdf2qNkxMNgJWNkxMAAAAAgAA/7ED6ANSABIAGwAItRkUAgACLSsBEQcuAic0PgE3FQ4BFRQWFxEFFyU3Jic1FhcCXph/0HYBcMR4eZysgwINFf7bUkJamnIDUvynSAxakFBOilwOYBV+T1WAEQL3+9k/LycQYBNFAAAAAf///2oDDgNSAG0AVEBRWFBPPDowJQcDBGUjFQoEAAYCRx0BBgFGRAEERQAEAwRvAAMFA28ABQYFbwAGAAACBgBgAAIBAQJUAAICAVgAAQIBTGxrYWBXVignIycUBwUXKyUOAyIuAi8BDgEHIiY+ATMyNjcOAi4DJz4BHgIXNjciDgEvAS4EJz4BHgUfATY1Jy4ENjceBAYPAQYPARU3PgQWFw4DDwEGJgYvAQYHNj8BPgIeAQMOETI0Ojg0LCIICj/EdQoQAgwMYaY5FCg0MjYwLhNAcEpCIBAdDwQMKBMuGywyIhoDJ0Y4MCIcEg4CAgYMCCYgHAoYGyk8IhQCAgYLBQQEBQMcHjA2SCYBFiIsFzAZJiYHCQ0cAwccFSxCQk7rLUAkEAoOEAUGgJIBDhYOeGgICgQGGihILRsKEiwqGUlZAgICBQMUHCw+KBAICBoeJiAeBwlEKQgFKChAPlAlDiguMDQsFCMPCAlECgYkHiASAg0rSCwkBw4HBAIDAlJMBAYXERgYAhgAAgAA/2oDWgNSACYARABeS7AhUFhAJwADBQIFAwJtAAIABQIAawAABAUABGsABAEFBAFrAAEBbgAFBQwFSRtAHQAFAwVvAAMCA28AAgACbwAABABvAAQBBG8AAQFmWUAMQD04NjEsODYzBgUXKwEWBwYhIyIGDwIOASsBIiY/AT4CNzY7ARY3Njc2NzY3NjI2FxYnFAcGBwYHFCMnIgcGAxQrASImNxM+ATchMhYXHgEDUAoNMP71GA4WAgMfAxYOjAwMAQ4JDBIGAxVJSzliPjkeDQYBAgICLFUaLXtATTIzNwoCLgekDBIDggIaEAFNE0gaPD4B6i9D+BIPC8kPEhAMXj5AeiEVAg0WOzVUJyMEAgMhZDxIgi4WAQEBNgT+3QYSDQM1EBQBDgsXXAAAAAEAAP9qA98DUgBmAGNAD19ZGggEAQBTNjIDAwECR0uwJFBYQCAAAQADAAEDbQADAgADAmsAAgQAAgRrAAQEbgAAAAwASRtAGAAAAQBvAAEDAW8AAwIDbwACBAJvAAQEZllADEhFQkE8OicmLAUFFSsTJjU0NjcmNjc0Njc2MzIXHgYfARYVFAYdARQyBx4BBxQGIyIuBSMHBgceAhcOAQcGIyIuAS8BLgEHDgEjIi4DNzQ2Nz4BPwE2NScuAS8BIgcOAQcjIiYnJjU0lwUMCAEKCGZHTWdLShsuIhoWDg4FAR8KBAErMgEWFAUMCA4ECgEBAyEpDC4eBQECAySFHUAuIw0IJAQXYC4UJkIuJgEMEQYgDAgBARtCCAMCBQooFwECAgINAZALEgsiCAwiB06mIiUfCx4iKig2LiACLyUIHgYCAgJAcDwYQAgMEA4QAgJWJwsUGhgCDgM2CgwLBAICARkWAggOIBMXFBIBDAEBAQECBmgkAgwXJAMEAR8ZmgAAAAAFAAD/aAPoA1QADwAYACEASwBcALFAEjMqKQMICTkmAgMGSUACAgMDR0uwJFBYQDkACQ4IDgkIbQoBBwgGCAcGbQAICwEGAwgGYAUBAwQBAgEDAmAAAQAADAEAYAAMAA0MDVwADg4MDkkbQD4ADgkObwAJCAlvCgEHCAYIBwZtAAgLAQYDCAZgBQEDBAECAQMCYAABAAAMAQBgAAwNDQxUAAwMDVgADQwNTFlAGFlYUVBFRDs6ODcyMBQSFBMUExYXEw8FHSslFgcGIicmNzYyFxYyNzYyJxQOASY0Nh4BFxQOASY0Nh4BNzQmBgcmJzcXFBY+AS4BJyIHJyYPAQYHJiIGFxQWFwYVFB4BNjU0Jz4BNxQOAy4CND4CHgMCYwkJIpoiCQkDCgQbhhsECqgeKB4eKB7cHigeHigejCY6E0hlI3AcKh4CGhceDnwKBCZlSBM5KAEUEgSe25wEERTIUIS8yLyEUFCEvMi8hFDHCQgjIwgJAwMcHANiFRwCICgeAhwVFRwCICYgAhosGygCEzIEnhoUHgIcKhwBHBwDDK4EMhQmHBQgCBAQT3ABck4SDgggA2a4iEwEVIDAxMCAVARMiLgAAAADAAD/sQNZAwMACAASABwAFEARGRUNCQYDBgBFAAAAZhEBBRUrBQYiJz4BNx4BAxEUBgcmNTQ+AQEUBy4BJxEeAgJ4X9tgTW4SE27IjnFlXqICWWVyjAFkpFwaNTUwjE9QigLs/vGM6Dd4nGi2dv5snHg36IwBDxF4tAAAAgAA/7EDWQMLAD0AXQBmQGNTAQIJDAEBAEwBBAFcAQMEQwEHBQVHAAgJCG8AAAIBAgABbQABBAIBBGsABAMCBANrAAMFAgMFawAGBwZwAAkAAgAJAmAABQcHBVQABQUHWAAHBQdMVlQqIiYkJC8lJS0KBR0rATQuAy8BLgMnNDMyFh8BHgEzMjY1NC4BByIOAgcUHgIfARYXFhQGJyIuAyMiBhUUFhcyPgIXFAYjIicGIyIuAic0NyY1NDYzMhc2MzIeAgcUBxYCjxYgMiocUwgWDAYBUBgmCxUKGg4aIEBeNiZIPiQBFCwsJFEzDBIuIx0sHhQgDhwciF4pSkAizH5YSTorKFCSajwBCS1+WEk6KylPkmo+AQgsAQEcLh4YDgYUAggKDgkrDAoTCQ4kGR8wHAESIj4pIjQgFgcUDAgLLB4BEhoYEiIYNEgBFChAT1l+LQk+apBRKSs6SFl+LQk+apBRKSs6AAAAAAIAAP+xA6EDUgBSAFYAi0AaVlVPRTs6MAcABVAmAgQAVCUbERAGBgEEA0dLsCRQWEAqBwEFBgAGBQBtCAEABAYABGsABAEGBAFrAwEBAgYBAmsAAgJuAAYGDAZJG0AgAAYFBm8HAQUABW8IAQAEAG8ABAEEbwMBAQIBbwACAmZZQBcBAElHQkA3NSooHx0YFg0LAFIBUgkFFCsBMhYXFA8BFxYVFAYjIiYvAQcXFhUUBiMiJi8BBwYjIiY1NDY/AScHBiMiJjU0Nj8BJyY1NDYzMhYfATcnJjU0NjMyFh8BNzYzMhYVFAYPARc3NgU3JwcDUCIuATRgHwQwIBosBx+tHwQuIhsqCB9VEQsiLiAYVztXDg0hLh4ZWB4ELiIaLAcerR4ELiIaLAgdWwsNITAiGFg7Ww3+Uq07rQGhLiE2EyFdDA4hMB4ZXDtbDg0hMB4aWx4FLCMaKgkdrx4FLiEaLAceWA4NITAgGFk7WQ0NITAeGVofAywhGSgJHrEgBJI6sDwAAAAABAAA/18D5gNTAAkAEwA3AF8AbEARXFMdFAQAAQFHTURDOi0FBURLsCRQWEAcBwYCBQAFcAMBAQIBAAUBAGAABAQIWAAICAwESRtAIgcGAgUABXAACAAEAQgEYAMBAQAAAVQDAQEBAFgCAQABAExZQA1ZVhE6GTUUFBQSCQUcKwEUDgEmJzQ2MhYFFA4BJic0NjIWFxE0JgchIgYHERYfAR4CNhY2FTIXFhcWFzYfARY2Mj4DNwYHFgcGBwYnJjcvAQcWBwYnJicmNyYnJjYfARE0NhchMhYHETc2FgHnRmRGAUhiSAEXRmRGAUhjRn4kLP2ULyABGBotEzQcMg4yJg8DAg8TBD5GExYmHigiKm5EjC88JEI6KzACARoBAjAsOkIkOi6MRA4YFQ00JgK9JTYBDBUYAbUuQgJGLC9CQi8uQgFELS9CQpMBdDAqASYz/ogNCRAHBgYCBAgDDwQBDg8zAgMBBAoEEgwQUzmfZT8TEhocQLYGvEAcGhIUP2WeOVMVHhAIAYMoOgE4Kf59CA8cAAARAAAAAAUGAnUADQAgACoANAA1AD8ASQBXAFgAZgB0AIAAgQCPAJ0ArADAAU5AM6ymAgAMmZCLgnwCBggKcAEGCGIBDwafl5KJhHp2bmhhWlJLRkE8NzEsJyIaCQAYAw8FR0uwCVBYQDcADgwObwAMAAxvAAAKAG8ACggKbwAIBghvAAYPBm8ADwMPbwUEAgMHA28NCwkDBwEHbwIBAQFmG0uwClBYQDcADgwObwAMAAxvAAAKAG8ACggKbwAIBghvAAYPBm8ADwMPbwQBAwUDbw0LCQcEBQEFbwIBAQFmG0uwC1BYQDMADgwObwAMAAxvAAAKAG8ACggKbwAIBghvAAYPBm8ADwMPbw0LCQcFBAYDAQNvAgEBAWYbQDcADgwObwAMAAxvAAAKAG8ACggKbwAIBghvAAYPBm8ADwMPbwUEAgMHA28NCwkDBwEHbwIBAQFmWVlZQCG/vbq4sa+pqKKhf355eHJxbWtkY19dT01EQx4dJhQQBRYrJTcDLgEiBhUDFx4BNzI/AQM0JyYiBwYVBwMXFBcWMjY1JRcHBiIvATc2MjcXBwYiNSc3NDITAxcHFCIvATc2Mh8BBwYiNSc3NDIfAQcGIyImNyc3NDY3MhMDFwcUBiMiLwE3NjMyFjcTBxQGIyIvARM2MzIWNxMHBiIvARM0NjIWEwMTBxQGIiY3JxM0Nh4BFxMHFAYuATcnEz4CFxMHFAYiJi8BEz4BMhcWFwEUBiMhLgE1ETQ3NjMyFhc2MzIWAbYICAEICggHBwEIBAynBgcHBQgFBwEFBgMFDgr9ugsLAgYCCgoBCDEODgIJDQ0JnmkODgwBDAwBDDQNDQEOCwsONgwMAQgDBgEMDAQECNeiDAwGAwkBCgoBCQQENgoKBgUKAQkJAQoFBjYKCgEVAgkJCAkI2m4ICAoIDAIICAgMBjkICAoKDAEGBgEIDgN7CAoOCgEGBgELCwMIAQJ1XkD+SQcKEC82bKAJHiBBXFSHASQFCAgF/tyHBQgBHXUBRwkFAwMFCQP+vYQGBAYJB8tHRgUFRkcFJ3NxBQVxcwX+/wESiYQGBoSJBgKNiAgIiI0HEoKJCQQFiYIEBAH+7gFb1IkEBgqJ1AoGLP77iAUGC4gBBQsIE/7mhwwMhwEaBQgI/l0Bof7jhQYIBgiFAR0GCAIEE/7tgwYKAgYIgwETBwgCBv7igQcKCgeBAWUICQMECv6mQVwBCgcB9g0FE5JsDFwABP/9/7EDXwMLABQAKgBCAE8AbkBrIAEABQFHAAgJBAkIBG0ACgQFBAoFbQAGAAIABgJtAAIBAAIBawABAwABA2sAAwsAAwtrAAsLbgAMAAcJDAdgAAkABAoJBGAABQAABVQABQUAWAAABQBMTUxHRkE/PDoVJiIpJRIjFSMNBR0rJTQnJiMiBwYVFBYzMjc2MzIXFjI2NzQnJiMiBwYVFBYXMjc2MzIXFjMyNjc0Jy4BIyIHDgEUFjcyNzYzMhYXFjMyNhcUDgEiLgI+ATIeAQJ1EWuOSlYYEAwCEko+fl8LEhA2FISuVVQbFA4EEEVIm3UNCA4UPBdGumJyWgwSGBAHEEphWag5DAsQGHJyxujIbgZ6vPS6fq8SCkATBRgLEAUPOgYQgxYMTxgHHQ4SAQQTRQgUmBoNKSoaBBYhGAEEFSYiBxZBdcR0dMTqxHR0xAAAAAQAAP9qAsACwwAMABAAFAAeAFNAUAYBAEQACAAHBggHXgsBBgAFBAYFXgoBBAADAgQDXgkBAgAAAlIJAQICAFgBAQACAEwREQ0NAAAdGhcWERQRFBMSDRANEA8OAAwADCIjDAUWKyUVFAYnIwc1ISImPQElFSE1JRUhNSUVITU0NjMhMhYCv0AuIJH+2S1AArP9TQKz/U0Cs/1NQC0B2C1ClyUvRAGWlkIwJbaPj7ePj04lJS9CQgAGAAD/agNTA1IABwALAA8AEwAXABsAdUATCwEEAQFHFxYVExIRDw4NCQoBRUuwDlBYQCIDAQEEAW8ABAUEbwYBBQAABWMAAAICAFIAAAACVwACAAJLG0AhAwEBBAFvAAQFBG8GAQUABW8AAAICAFIAAAACVwACAAJLWUAPGBgYGxgbGhkREREQBwUYKwUhESMRIREjJTcFBwE3BQcBNwEHAwEHCQE1IRUCz/2QWQMjWv3zEgG1Ev6EJgGUJf7bOQFXOXkBCkf+9f63Ab89AQz+mwFlGVdcVwEsUr1RAYNF/uFEAfH+mjUBZf0BWVkAAAAEAAD/sQPpAwsACAAcACUAPABcQFk4AQABMgEFADMBBggxFw4DAwIERwABBAAEAQBtAAAFBAAFawAJAAQBCQRgAAUABgIFBmAACAACAwgCYAADBwcDVAADAwdYAAcDB0w7OjYjFBMULCQTEgoFHSsBFAYiJj4BHgEBNCYjIgcXHgEOAScuASceATMyNgE0JiIGFBY+ATcUBiMHDgEjIiYvATUXNjMyFzc+ATIWA3NQcFIESnhI/lZSOQ8POiskI1QrDC4LEkIoOlAB0GSNZGSNZFSUavQGbkhEaA6A2Sw1BwyfAZTSlgINOFBQcFIESv4mOlIEFxFUViQSBBIFIihQAdlGZGSNZAFiSGqUskhkVkAz8FgbAeNolJYAAAIAAP/FBC8C+AAcAC0AREBBHBsAAwIAJyYlAwMCAkcFAQIAAwACA20ABAAAAgQAYAADBwEDVAAHAQEHVAAHBwFYBgEBBwFMGBMVFRMTFRMIBRwrATU0Jg4BFREUBiImPQEzFRQWPgE1ETQ2HgEXFQcXMxUUBiImPQEXNxUUFj4BNwJRIi4ijMeMtyIuIo7DjAFt3reMxoxJbSAyHgEBxUIXIgIeGf6qYoqMY5WSGCICHhoBWl+IAYhgTCBalWOMimOWIiCXFyICHhkAAAIAAP9qAqsDUgAeAEoAZbUFAQACAUdLsCFQWEAgAAEDAXAAAgAABAIAYAAEAAMBBANgAAUFBlgABgYMBUkbQCUAAQMBcAAGAAUCBgVgAAIAAAQCAGAABAMDBFQABAQDWAADBANMWUALSEYXJyUeKCIHBRorARQGByInBgcGExYGByMiJicmPgM3NjcmNTQ2MhYXFA4BJyInLgE+ARcWMzI+Ai4DDgMHFBcWDgEmJyY1ND4CNzIeAQHWQCwhHSIeihkBEAsDCxACBwoYJCgWIicIPlo+1liWWCQlDAwFFAwcIDZkRiwCKEpgcGBKKAEdBQYWFgYkNFZ6QViWWAITLT4BFCYsz/7wDRIBDgxGiGpmSCIyKhMYLEBAMliWWAEIAxQXDAEILEZkbGRGLAIoSmA4QDoLFgwIC0RQQnhYMgFWmAAAAAMAAP+xA1oDCwAPAB8ALwBBQD4gAQAFGREBAwMACQEBAygBBAEERwADAAEAAwFtAAUCAQADBQBgAAEEBAFUAAEBBFgABAEETDU2FyYmIwYFGislETQmIyEiBhURFBYzITI2JRE0JiMhIgYVERQWFyEyNhMRFAYjISImJxE0NjMhMhYBiQoI/vQICgoIAQwICgF3Cgj+9AgKCggBDAgKWRQQ/O8PFAEWDgMRDxZkAjsICgoI/cUICgreAWUICgoI/psHCgEMAbP87g4WFg4DEg4WFgAAAQAA/7ACOwNSACIAV0AKDQEBAwEBAAUCR0uwJFBYQBYAAwQBAQUDAV4ABQAABQBcAAICDAJJG0AeAAIDAm8AAwQBAQUDAV4ABQAABVQABQUAWAAABQBMWUAJJRERKRYjBgUaKyUXDgEjBi4DJxEjNT4ENz4BOwEVMxUjERQeAhc2Ag8sDGIyOmI8LhABXihAJhoMAgEEAoi6ugYUJBssbIQTJAEgMkRCIQEweA4yMkAuGgME7Yz+3xEcIA4BAQAABAAA/7EDsANSAAMABwAPABkAnkAPGAEBBBEJAgUADgEHBQNHS7AkUFhAKAAIBwhwDAMLAwECAQAFAQBeDQYCBQkBBwgFB14ABAQKVg4BCgoMBEkbQC8ACAcIcA4BCgAEAQoEXgwDCwMBAgEABQEAXg0GAgUHBwVSDQYCBQUHVgkBBwUHSllAKBAQCAgEBAAAEBkQGRcWFRQTEggPCA8NDAsKBAcEBwYFAAMAAxEPBRUrARUjNSEVIzUTNxEhETMVNwERByMHIzUjETcB9FEBL1FRjf1mtnkBvPK2eXnePQJg8vLy8v5YjQG8/bd5eQKa/cvyenoChqEAAAAAAQAA//cDiALDAC8ATUBKLiwqIAIFBQYZAQQFFhICAwQLAQECBEcABgUGbwAFBAVvAAQDBG8AAwIDbwACAQJvAAEAAAFUAAEBAFgAAAEATCQWFiMRIigHBRsrAQYHFRQOAyciJxYzMjcuAScWMzI3LgE9ARYXLgE0Nx4BFyY1NDY3Mhc2NwYHNgOIJTUqVnioYZd9Exh+YjtcEhMPGBg/UiYsJSwZRMBwBWpKTzU9NhU7NAJuNicXSZCGZEACUQJNAUY2AwYNYkICFQIZTmAqU2QFFRRLaAE5DCBAJAYAAAABAAD/pQNDA1MANQB2QBMpAQMEAAEFAxkBAgAFA0cXAQBES7AkUFhAIgABAgQCAQRtAAMEBQQDBW0ABQAABQBcAAQEAlgAAgIMBEkbQCgAAQIEAgEEbQADBAUEAwVtAAIABAMCBGAABQAABVQABQUAWAAABQBMWUAJJCclHB4SBgUaKwEVBiMOAgcGJy4GJzMeAxc2Ny4BNTQ2HgEVFA8BBiIuASc2NTQmJyIGFRQWMzIDQzg2JHBcGS0uDyQ8NkI0Mg6eDjJCRiteQk9adMdqIAsHJCQgDBEgHB4kdlojAYVvDUyWWg8ZGwkeQFB8lMx0esqYbjZehSikaGuKAXZrWUYCAQYWEjotMDIBODJoeAAAAAAB////9wQ7Al0AhgAyQC90VgIDAiUBAAMCRwAEAgRvBQECAwJvAAMAA28BAQAAZoOBY2FOTT89LCoWFAYFFCsBFgcGBwYHBhcWFzMVFxYfAR4BDgEjBwYmLwEuAwciDgMVFAYPAQYHIwYuAi8BLgQnJjQ/ATYzNx4BHwEWFx4BHwEeAzI/AT4BPwE2Jy4BLwEmJyY3Njc2FxYXHgIUFgYdAQcGHwEeAR8BFj4CNzY3PgE/AjYXNzYWFwQuDWENFywGChEKJAEBTxwEAgQGFhaODiQLCxEsICQOAQYOCggEAgIKFEAoUkIwEA4FFDw6TiIEAgIJF5kHDAMDCQQLHggJEB4YFhAHAwIKAgUDAwEIAwQOIQgLCQwdaC4dDA4KBAQBAQECAQoICQUUFiQUIRsCBgMFCAgDoBYcAwIwJIASHjcSFxYMIgEBSTIHBBYQDgMCCggGDDAmHAYEDBQmGQgOAwMLAQMYIigMDgUYTF6MUgkMAwMLAQEEAwIGDBw6ERAiMBwQAwMCFBAuHicXJAgGEwUCDAoHDgEBBgMKEBQeIBguFxEKFgwUBAIBDhg0IjpDBggCAwICAgEDCAYAAAAABgAA/40EdwMwAAgAFAAdACkARgBYAGhAZSQPAgMCPTICCQNMSjwDCwkDR0sBC0QACgAKbwQBAAEAbwUBAQgBbwAIDAhvBwEDAgkCAwltAAkLAgkLawALC24ADAICDFQADAwCWAYBAgwCTFZUT01EQjUzIxUkExQkJBMSDQUdKwE0JiIOARYyNgE0JgciBgcUFhcyNgM0JiIGFBYyNgE0JgciBgcUFhcyNicmIyIOARcUFwYjIiYvAS4BIwc3JjU0PgEXMh4BARQGBxcnBiMiLgE0PgE3Mh4BAUQcLyQBJi4cAZ4cFhAYARoPFhyDHC8kJC8cAWIeFQ8YARoOFhyTEhZenlwBDRQSDxoSGQcuBY0oomy8bWKudgFcTEIfb1QmXp5cXJ5eWp5gAlEXHB4rHBr+/Q8aARoOEBgBGAEsFxweKxwa/v0PGgEaDhAYARjuA1aUViwpAgIDBAEKRnlyoF6eXAFIhP53QXYxZTwUToieikwBTooAAAf//v/GA/EC/AAJABMAHQArAE8AZAB5ABlAFkIBAAEBRwABAAFvAAAAZkVEMjECBRQrJTYuAQYHBh4BNjc2LgEGBwYXFjYXDgEuAT4BFx4BNy4CBw4BFx4CNz4BNxQOAy4DNzQ2Nz4BFxYHBh4BPwE2MhYHDgEeARceAgMeAQcOAScuATc2JgcGJicmNjc2FjceAQcOAS4BNzYuAgcGLgE2NzYWAXkLCicsCw0KJi5ABQYOEgMJEQgQZRl+eiw0dDs+NpQFWJJQfKQIBVqOUn2ipShSapKcmHRMAk5HXsIoJBkCBAYFC054MhkBBAoEByA0JCgXDgoFGA0MDgULMCQNGAIDEAwiQnwxHBYFHB4OBBAURmAwEBoIEhBEiIYTJhEQERMmFBJVBxAFBgcSCAIGNTk0JmhoNBAQZCE1UigIDYRSNVIoCA2ETyZOTDYoBiBIYD9AkkdeSigkUQgGAgEDIUVABwgGBAEKIDwBOhtEIAwMAwUYDSM2CAMQDA4WAwcUQTaOPw8QDBoQLmRNHgsDEh4cAg8qAAQAAP9qA6EDCwADAAcACwAPADFALg8MBwQEAUUKCQIBBABEAwEBAAFvBQIEAwAAZggIAAAODQgLCAsGBQADAAMGBRQrARElEQERIREBESURAREhEQF9/oMBff6DA6H+BQH7/gUBIf6UNQE3AZ7+kQE7/pb+SUYBcQHq/kUBdQAABv/+/2oD6gNSAAUAPQBFAE8AYABxAKFAEzQBAANLRUEhIB8PDgMCCgQAAkdLsCRQWEAtAAMCAAIDAG0ABAAHAAQHbQACAQEABAIAYAoBBwAGBwZcAAgIBVgJAQUFDAhJG0A0AAMCAAIDAG0ABAAHAAQHbQkBBQAIAgUIYAACAQEABAIAYAoBBwYGB1QKAQcHBlgABgcGTFlAHWJhUVBqaWFxYnFZWFBgUWBEQjIwLiwpJRcTCwUUKxM0NxMuASUUDwEOAg8BAzc+ASYjByYnIg4BFBYzHwELATc+ASYjByMiJz4BMzIWFyMiBgcUHwEeAh8BFgUTFBcGIyInARYVFAYHEzY1NAEyHgMOAiIuAj4DEzI+AjQuAiIOAhQeAkclzW2GAtACBQMICgUrmzELCAwJcypHBgoCCgYsQ16cMQsIDAlzDQkFOr5uUpY6Bh8oAQECAQgCBhcj/uWFAkZIPjsB8TV0YoQh/oRmuIhMBFSAwMTAgFQETIi4ZmGwgExMgLDCsIBMTICwAV5bVP3PNdCTCwsbEBIwCI8BzQQCEhAGAQUGDAgKBLf+5wHQBAISEAYBWWg6NywfBwcMBRAGCiY8df6XBAMYEgJpYW11xDoBe148FwE7UIS8yLyEUFCEvMi8hFD8L0yAsMKwgExMgLDCsIBMAAAAAv/+/7EDFQNMABMAJABJtx8XCQMAAQFHS7AZUFhAGQABAwADAQBtAAACAwACawACAm4AAwMMA0kbQBMAAwEDbwABAAFvAAACAG8AAgJmWbY0ODkzBAUYKwEGBwYrASImPwEyLwEmNzY7ATIXJRYHARMWBisBIicDATY7ATIBTQWKDxWGDAoFjQEBWgcHBQyGFg8CHQYG/tm8BgsMhhcOvQEoDhaHDAHeCvUZEgv6AZwMCAkaxwkM/ff+qAsSGQFcAg0ZAAUAAP9lAy0DWQAVACgAPABKAGEAKEAlYQEAAQFHSAEBRQoBAEQAAQAAAVQAAQEAWAAAAQBMIyIcGgIFFCslFRQHBgcGJicmJzQ3PgE3Mjc+AR4BJwYPAQYjJicmJyY+ATMyHwEeAQUOAQcGJyYvASY2NzYXMh8BFhcWARYGJwMmNz4BFxYfARYFFgcGBwYHNQYmJyY3Mj8BNjc2Fx4BFwGvAwcVH44TCAICAyBVASEIHBsOUwEcQ5kKEwsGAwUKGBMIaW8NDgHMBF4cFQ8HXxsHAgoTGwFChxYEEP6FA0Eg0gUPF7ogFwUMCwF0ARAIryYNDRgJEREBKVQOBQ8VG1IFckejBxIEBjYWCQsHCAYoZScLBgsWgB8IFjEBEw4cKmYkKy0FGLUeeAoICwabKwscDBgKFiwHBQwBSzkVMgFNFA8YNAkFFKqgcBYLBioJBAEDCg0aFzlyEwILCgx8IAALAAD/agNKA1IACQAPABcAKgA7AFcAXwB4AIQAlACmAydAJKWhhH57BRYVmAEbFjEBAQkGAQIBVj48IBwFBgASNioCBwAGR0uwCVBYQGsfARsWHRYbHW0GAQQFCQUECW0TDQsDCQEFCWMPCAIHAAwMB2UkIyEDHgAVFh4VYCIBFiABHRkWHWAAGQ4BBQQZBV4DAQEAAhIBAl4AEhEKAgAHEgBgABcYDBdVFBACDAAYDBhdHAEaGgwaSRtLsApQWEB3JCMCIR4VHiEVbR8BGxYdFhsdbQYBBAUNBQQNbRMBDQkFDWMLAQkBBQljDwgCBwAMDAdlAB4AFRYeFWAiARYgAR0ZFh1gABkOAQUEGQVeAwEBAAISAQJeABIRCgIABxIAYAAXGAwXVRQQAgwAGAwYXRwBGhoMGkkbS7ALUFhAXgYBBAUJBQQJbRMNCwMJAQUJYyQjIQMeABUWHhVgIgEWIB8dAxsZFhtgABkOAQUEGQVeAwEBAAISAQJeABIRCgIABxIAYAAXGAcXVBQQDwwIBQcAGAcYXBwBGhoMGkkbS7AOUFhAax8BGxYdFhsdbQYBBAUJBQQJbRMNCwMJAQUJYw8IAgcADAwHZSQjIQMeABUWHhVgIgEWIAEdGRYdYAAZDgEFBBkFXgMBAQACEgECXgASEQoCAAcSAGAAFxgMF1UUEAIMABgMGF0cARoaDBpJG0uwJFBYQGwfARsWHRYbHW0GAQQFCQUECW0TDQsDCQEFCQFrDwgCBwAMDAdlJCMhAx4AFRYeFWAiARYgAR0ZFh1gABkOAQUEGQVeAwEBAAISAQJeABIRCgIABxIAYAAXGAwXVRQQAgwAGAwYXRwBGhoMGkkbQHIcARoeGm8fARsWHRYbHW0GAQQFCQUECW0TDQsDCQEFCQFrDwgCBwAMDAdlJCMhAx4AFRYeFWAiARYgAR0ZFh1gABkOAQUEGQVeAwEBAAISAQJeABIRCgIABxIAYBQQAgwAFxgMF2EUEAIMDBhZABgMGE1ZWVlZWUBGlZWVppWmpKKgn5uZl5aSkYqJg4J9fHp5c3JnZmVkX15bWlNSS0pGRUNBOTc1NDMyMC8pKCQjHx0bGhEREREREhIjIiUFHSslFRQjIic1NjMyFxUjNTQyJTM1IxUzETsCESMVBiMiJyY9ASMVFBcWMj8BNTQnJiIHNSMRMzUWMzI3Njc1IxQHBiMiPQEzNTQnJiIHBh0BFBcWMjc2NzYBNTQiHQEUMgEUBw4BBwYgJy4BJyYQNz4BNzYgFx4BFxYBMwcVIzUmJyYnMx8BFRQHBiInJj0BNDc2MhcWNxEjNQYjIicmPQEzFRYzMjc1Ah4WDQwMDRa9MzL95TyuOzehMjIRDwoBATIFBzQe8AUKOhgyMhkbHgoFvDMBBBIaZA8WSxYPEBZOFAoCAf6tMDABkQ4IMiBm/mJnIDIHDw8HMiBnAZ5mITIHDv3TOUM4CBoVEDwn9RAVSxYPDxZLFRC7Mx4cGQgEMwIKDxGcdiUMqAwmGRkmVDQ0/sIBFNMXCwISy9ocDRUiNW4pDh8eef6OGx8fDy8HHQUUJjE5LBUcHBUsYCwVHR4PDwUCGXUnJ3Un/oSDQCEuAgwMAywiPgEIQCEuAwsLBCwiPgJD35eXKk05L5MnYS4UHR0VLWEtFRwcFS7+6R8jFQ0d3OEMGNUAAQAA/7EDHANSACEAPUASEgUAAwABAUcaCQIBRQQBAgBES7AXUFhADAAAAQBwAgEBAQwBSRtACgIBAQABbwAAAGZZtRwnEgMFFysBEyYiBxMuAicWMzI3Fh8BFhc3PgE/ARYyNwcGDwEGBwYB3wgjLyQIF45kMyAcGCYjKF01GD0oNCA8Hj0gIRIKHxUHUQE8/nUHBwGLJ/ymTQgIPkKaWCdjQVI5aggIMRsRNiUKigACAAD/sANZAwsALgBhAFlAVlkJAgQBAUcACQACAAkCYAALAAABCwBgAAoAAQQKAWAAAwUGA1QABQcGBVQABAAHBgQHYAAFBQZYCAEGBQZMVFNRT05MPDs5NzY0KignJiQjIRIrDAUXKwE0Ji8BLgE0PwE0JyMiDwEiJgciBg8BBgcOAgcUFhUUBhQWMjYXMhYzMjc+AjcUDgEHBiMiJiciBiciJjU0NjU0JjU0PgI3Njc2MzIWNzI2FzIWFRQGFRQWFB4BFx4BAxEIBgkDBAIDBQgKFiEigCIYOhIyTCU1SBoBDgwOGTYOIH4fZTpIdkRHTo5WRXEffiANNg4pOAwOFCpGMCxWbEQigCEKLAotKgYCBAQCCQoBhRlMEBkIGBwaJRUKAgMcAQwHEx4cKYKESRZaFg0yFhIOARIVGXiaTVy2iiAZEAESAT4pDjANF1oXPXhyZiQhIiwcAQYBOC8NMg0FCgoEDgIXWAAAAQAA/7EDWQMLAA8AEUAOAAEAAW8AAABmNTMCBRYrAREUBgchIiY1ETQ2NyEyFgNZXkP96UNeXkMCF0NeAmr96EJeAWBBAhhCXgFgAAEAAP+xA1wDCwBLAEhART8BBAUKAQEEQgYCAAEDRwAEBQEFBAFtAAYAAgMGAmAAAwAFBAMFYAABAAABVAABAQBYAAABAExJSDs5MS8rKSYnIwcFFysBFA4BIyInNjc2Nx4BMzI+ATU0LgEnIg4DBxQWFxY/ATY3NicmNTQ2MzIWBxQGByImNz4CNTQmIyIGFRQXBwYXLgE1ND4BMh4BA1lyxnQ+PCEKBhkLOiNEajpEfFA7ZkY0FgEsLBAFBAMCAwkddF9UYAFOOyIoBwQWDB4cIzAONwkCc450wu7AeAFedcR0EjQoE2MWIEyGVEBwRAIiNEZKJjpYEgcSEQ0EDQsiMlR6XElfhAEyIRNCMBMcJD4xKBzpJzwz1IJ1xHR0xAAAAAACAAD/sQPoAwwAHAA5ADVAMjIBAQAaAQMBAkcAAQADAAEDbQADA24FAQQAAARUBQEEBABYAgEABABMKCofFRUVBgUaKwE0LgMOAwcGIicuAw4EBxQXCQE2NxQHAQYiJwEnLgM1NDY3Mh4CFz4DFzIWA6EYJjYyPEA8JBAKIgoOKDhEODYyKhQCaQFEAURpR4D+pQoeCv6kDwoqIhqOfSJIPi4TFCxARiN9jgIFLkQqGAwEGDAgEg0NDyYqHgIGHiRKK11p/sgBOGlde4D+sQoKAVAPCjY2UCV7igEYKiIVFCQoGgGMAAAAAQAA//kDoQMMACUAMEAtBAECAQABAgBtAAADAQADawADA24ABQEBBVQABQUBWAABBQFMEyU1IxUkBgUaKwEVFAYHIyImPQE0Jg4BBxUzMhYXERQGByEiJicRNDYXITU0PgEWA6EWDiQOFlJ4UgE1Fx4BIBb96RceASAWAXeS0JACEY8PFAEWDo87VAJQPWweF/6+Fh4BIBUBQhYgAWxnkgKWAAABAAD/sQPoAwwAHAAhQB4RAQABAUcCAQEAAW8DAQAAZgEAFxUNCwAcARwEBRQrBSInAScuAzU0NjcyHgIXPgMXMhYUBwEGAfQOC/6kDwoqIhqOfSJIPi4TFCxARiN9joD+pQpPCgFQDwo2NlAle4oBGCoiFRQkKBoBjPWA/rEKAAH//QAAAp8CwAATABVAEgkBAEUBAQAAZgEAABMBEgIFFCszIi8BJj4BFh8BAT4BFx4BBwEGI/kiFrQQCCw6EnYBKBA2GhgMDv6iFCQc7Bg4JAgYmgHaGAwOEDYa/dAgAAEAAAAAAdYCYgAdAB5AGx0WDgYEAAIBRwMBAgACbwEBAABmFBoUEwQFGCslFhQGIi8BBwYiJyY0PwEnJjQ3NjIfATc2MhYUDwEBxBIkMhKEhBIyEhAQiooQEBIyEoSEEjIkEorCEjIiEJiYEBASMhKcnhIyEhAQmJgQIjISngAAAQAAAAACRAKAABMANUAyAAUABW8AAgECcAQGAgABAQBUBAYCAAABWAMBAQABTAEAERAODAsJBwYEAgATARMHBRQrATIUKwEVFCI9ASMiNDsBNTQyHQECJh4e0mTSHh7SZAGQZNIeHtJk0h4e0gAAAAEAAAAAAkQBkAAHACBAHQIBAAEBAFQCAQAAAVgAAQABTAEABQIABwEGAwUUKwEyFCMhIjQzAiYeHv34Hh4BkGRkAAAAAgAAAAACNAJRABUAKwAcQBkpEwIAAQFHAwEBAAFvAgEAAGYXHRcUBAUYKyUUDwEGIicBJjQ3ATYyHwEWFA8BFxYXFA8BBiInASY0NwE2Mh8BFhQPARcWAV4GHAUOBv78BgYBBAUQBBwGBtvbBtYFHAYOBv78BgYBBAYOBhwFBdzcBVIHBhwFBQEFBQ4GAQQGBhwFEATc2wYHBwYcBQUBBQUOBgEEBgYcBRAE3NsGAAACAAAAAAIiAlEAFQArABxAGSELAgABAUcDAQEAAW8CAQAAZhwYHBQEBRgrARQHAQYiLwEmND8BJyY0PwE2MhcBFhcUBwEGIi8BJjQ/AScmND8BNjIXARYBTAX++wUOBhwGBtvbBgYcBRAEAQUF1gX+/AYOBhwFBdvbBQUcBg4GAQQFAToHBf77BQUcBg4G29wFDgYcBgb+/AUIBwX++wUFHAYOBtvcBQ4GHAYG/vwFAAIAAAAAAlgCYwAVACsAK0AoHQECBQcBAwICRwAFAgVvAAIDAm8EAQMAA28BAQAAZhcUGBcUFAYFGislFA8BBiIvAQcGIi8BJjQ3ATYyFwEWNRQPAQYiLwEHBiIvASY0NwE2MhcBFgJYBhwFDgbc2wUQBBwGBgEEBQ4GAQQGBhwFDgbc2wUQBBwGBgEEBQ4GAQQGdgcGHAUF29sFBRwGDgYBBAUF/vwGzwcGHAUF3NwFBRwGDgYBBAYG/vwGAAAAAAIAAAAAAlgCdQAVACsAK0AoJQEDAQ8BAAMCRwUBBAEEbwIBAQMBbwADAANvAAAAZhQXGBQXFAYFGisBFAcBBiInASY0PwE2Mh8BNzYyHwEWNRQHAQYiJwEmND8BNjIfATc2Mh8BFgJYBv78BRAE/vwGBhwFDgbb3AUQBBwGBv78BRAE/vwGBhwFDgbb3AUQBBwGAXAHBv78BgYBBAYOBhwFBdzcBQUcBs8HBv78BQUBBAYOBhwGBtvbBgYcBgAAAAIAAP+cAkQDIAAoADEAQUA+CwEAAgFHAAIBAAECAG0AAAQBAARrAAMAAQIDAWAGAQQFBQRUBgEEBAVYAAUEBUwqKS4tKTEqMSMTLjwHBRgrARYVFAcGDwEGBwYHFCsBIjU2Nz4BPwE2NzY1NCcmIyIHBhUjNjc2MzIDMhYOAS4BPgEB7lYqDEwuKAgGAhCAEAQYEEAYGBYMHBocQEQaHKYGbEZggoQsOgQ8WDoEPALkPnpAPBQ8HiIaEBwODGIaFjQQDhASLBooJiQsKjKiRir9SDxaNgI6XDYAAAACAAD/agHMA1IACgAgAIRACR4dExIEBQMBR0uwJFBYQCcABAEDAQQDbQADBQEDBWsABQIBBQJrBwECAm4AAQEAWAYBAAAMAUkbQC0ABAEDAQQDbQADBQEDBWsABQIBBQJrBwECAm4GAQABAQBUBgEAAAFYAAEAAUxZQBcMCwEAHBoXFRAPCyAMIAcFAAoBCggFFCsBMhYVFAYjIiY+AQMiPwE2IgYHJz4BMzIHAwYzMjcXDgEBYDA0TjgwNAJGkGQuPA4aVB4aWsY0TipGEBYsSh5UtgNSNioyTDRcTvwYsv44JBQsTmCi/vZAPChWXAACAAD/zgMgAvIAHAA8ADxAOQAGBQZvAAUEBW8AAAMCAwACbQAEAAMABANgAAIBAQJUAAICAVgAAQIBTDw7NjUpKCQiGxoVEQcFFislNjIXFg8BBiImND8BPgEXFhQHBicmDwEGFBYyNwEWFA8BBiMiJyY0NjIXFj8BNjQnLgEPAQYiJyY/ATYWASYOKBAgICo4mnA4lEaUNhAQJCIyUpQaNEoaAew4OJ5KTD4yDhwqDjJInhwcGEAcMhAoDiIiMjaSdA4OIiQoOHCaOJREEjQQKBAgIDBSkhpMMhoCZjiaOJ5IMg4oHg4wSJwcShgaChoyDg4iJDI2BgAAAAACAAAAAAMUAqgAEwAnAD9APAkECAMAAwBvBwEDAgNvBgECAQECVAYBAgIBWAUBAQIBTBUUAQAkIh4dHBsUJxUnEA4KCQgHABMBEwoFFCsTMhcWBwYHBiM1Mjc2JyYjIiY0NiEyFxYHBgcGIzUyNzYnJiMiJjQ2kpImJk5QkCAicEY2HBAuPFZWAeCSJiZOUJAgInBGNhwQLjxWVgKokoyiqCQIRmxWPCRYfFiSjKKoJAhGbFY8JFh8WAAAAAH//v90A7gDYAAxAB9AHAABAAABVAABAQBYAgEAAQBMAQAqKQAxATEDBRQrFyInLgE3ATYXHgEXFgcBDgEnJjY3ATYWBwEGFxY3NjcBNiYnJgcBBh4CNwE2FgcBBvRmREgEVgHwUF4sRgwaUP4mKGAgHgYsAUwYNBr+tCwYDAwYFgHaMiA8Njb+EkIEZIZKAfAYNBr+EFKMSEbAXgHwUBoMRixgUP4mKAogGGQqAU4aNBj+tCwaCAIEFgHaMnYQDjL+EkyGYgRAAe4YLhr+EFIAAAAAAwAAAAAD6AJ2ABQAHQAsAENAQCIBBAUBRwYBAAADBQADYAAFAAQCBQRgBwECAQECVAcBAgIBWAABAgFMFhUBACooJSQaGRUdFh0LCgAUARQIBRQrATIeAxQOAyIuAzQ+AxMyNjQmIgYUFjcWPgEXFAYiJjQ2MzIOAQH0XKpwVigoVnCquKpwVigoVnCqXFyCgriCglwIOioEQlxAQC4OCBACdjJKUD4cPFJKMjJKUjwcPlBKMv4SfrJ+frJ+1ggMCg4sPj5aPi4wAAAAAv/+/1oD1ANaABwALgAjQCAnHxcDBAEAAUcAAAEBAFQAAAABWAABAAFMIyEVEgIFFCsBFgYHFxYPAQYHAQYnAyY2NwE2OwEyHwE2JyY3NgM2JwcGIyInJj8BJgcOARceAQOwJFhUEhAKMAwY/jAqFtIMBhIB0Bocnh4SHKg2Chwg0igGIAgEEgoMHBgwLBwMFBJCAz5qukAYHBqeHhD+uB4iATASKgwBSBIaKIKcHAwI/hAgMBAEEh4KDiIiEkIcGgwAAAMAAAAAArwCWAALABcAIwBCQD8AAwcBAgADAmAGAQAAAQQAAWAIAQQFBQRUCAEEBAVYAAUEBUwZGA0MAQAfHBgjGSITEAwXDRYHBAALAQoJBRQrATIWFAYjISImNDYzNSImNDYzITIWFAYjETIWFAYjISImNDYzAooWHB4U/agUHhwWFB4cFgJYFhweFBYcHhT9qBQeHBYBkB4oHh4oHmQeKB4eKB7+1B4oHh4oHgAAAgAA/9gDDALwAAsAGQAXQBQEAQBFGRUNBwQARAAAAGYSEQEFFCsBHgEdAQcBBzcBNzYBNyYnLgEjJw8BFhcWFwLOIB78/t7uMgEi/Db+WhgCMhYuDA4WEhwSGAwCqCBAEBD8/uA08AEg/Az9OBgsMhYaAhhQEBIYGAAAAAH/4P9iAsADVgAyADhADhIBAAEBRy0mCAYEBQBES7AhUFhACwAAAQBwAAEBDAFJG0AJAAEAAW8AAABmWbYZGBcWAgUUKxcGJyY3NjcmNx4CNi4BNz4BNw4BFhcyNjc2FhcWBgcOAQcGFxY3DgIHBhY3DgMHPAYUEgIELmQwCiwsEhAGHBZ0LhgSChAMkCIuiA4MGBwszAwQHDZ6OKBoAgRqMB5CKm4eihQMCBpkfpqiIFxECJ6uRixkFC5gPALwAgRCIBhuHCwkBgoYMBxQRAgGGDwQODgOCAQAAAACAAAAAAPoApoADQAZAAi1GRENCQItKwEWFA8BFxYUBwYnCQE2BQkBBicmPwEnJjc2AXwQEPb2EBAeHv7AAUAeAUwBPv7CIB4gIPj4ICAeAnwOJAzg4gwkDh4eASABHh4e/uL+4B4eIB7i4B4gHgAAAf/8/8wDiALyABoAIUAeAAUABW8EAQACAG8AAgECbwMBAQFmFCMhESQiBgUaKwEWBisBERQOASsBESMRIyImNREjIiY3ATYyFwN4EAoWVAIOEMzMwhwOVBYKEAGQECwQAVAQFv7KDg4MATb+yhQUATYWEAGSEBAABAAA/84D6ALuAAgAJAAtADcAZkBjCgEACQgJAAhtDQEIAQkIAWsAAQYJAQZrAAUABwkFB2AECwICAAkAAglgDAEGAwMGVAwBBgYDWAADBgNMLy4mJQoJAQA0Mi43LzcqKSUtJi0gHRoXEg8JJAojBQQACAEIDgUUKwEyFhQGIiY0NiUyFhURFAYjISImNRE0NjsBMj8BNjMhMh8BFjMBMjY0JiIGFBYBMjY0JiMiFRQWAfRAVlh8WFgBzio6Oir84Cg8PCh4HAweCh4BVB4KHgwc/uhokpLQkpIB1g4UFA4kFgHCWHxYWHxYljoq/j4oPDwoAcIqOh5cHBxcHv3aktCSktCSAXwWHBQiEBQAAAAD//j/hAPoA0IADgAeACYAQ0BAJSQjISAIBgQCAUcCAQBFAQEAAgBvBQECBAJvBgEEAwMEUgYBBAQDWAADBANMHx8QDx8mHyYYFQ8eEB0iEAcFFisBIycHIyIGHQEDJjclNhcTMhYVERQGIyEiJjURNDYzATUnDwEnBxUDWGR81rQ0TGwKIAKoJA7QEBYWEP0sEBYWEAKcSKaCilwCBpaWTjSgASgmDvgKIv6MGBD+KBAYGBAB2BAY/jyioDyEqtZWAAAAAgAAAAAD1AK8ACcAKgBWQFMpAQMCAUcqAQEoAQQCRgANDAEAAQ0AXgsBAQoBAgMBAl4JAQMIAQQFAwReBwEFBgYFUgcBBQUGWAAGBQZMJSIfHh0cGxoZGBETMxEREREREA4FHSsBIxUzFSMVMxUjFTMVFAYjISImPQEzNSM1MzUjNTM1IzU0NjMhMhYVATcnA9RkZGRkZGQYEPx8EBhkZGRkZGQYEAOEEBj9qPr6AlhkZGRkZDwQGBgQPGRkZGRkPBIWFhL+NJaWAAAAAgAA/6YD6AMWACcATgAoQCVGRDw4Fw8FBwABAUcAAwEDbwABAAFvAgEAAGZBQCwrFBMQBAUVKwUjNTQmJzY1NCYnLgEnNDcmJyY2MhYPARYVDgEHDgEVFBYXFhceARclFh0BITU0Nz4BNTQmJy4BJzQ2PwEmJyY2MhYPARYVDgEHDgEVFBYD6OA8fCgaBgIYAgwGAgQ2iDgECAwCGAIGGio4cBIGBgL+GLb9SlRMOCYGAiAEBgQEBgQESrRKBAoOBCACBiY4WpY2Nj4eNhAiIggQIhgGIhomUFAmPAYYIhAIIiIQKjAYLiIIajDWTi6KuCwiIEA4FDAsChgsDhIEAi4kMmpqMlIIHiwYCiwwFDhAAAAAAQAA/5wDrAMgACoAG0AYIB4WEgQAAQFHAAEAAW8AAABmGxoTAgUVKyUWHQEhNTQ3PgE1NCYnLgMnNDY/ASYnJjYyFg8BFhUOAwcOARUUFgLgzPxUzF5ELAoCDg4OAgoEBAgEBFrgXAYMEgIODg4CCC5GgEgyamoySCJGPBY2LgwMBB4cEBQCBDImNnR0NlgIIhweBAwMMDQWPEYAAgAA/5wD6AMgACgANABLQEgeHBQQBAIHBQEABAJHAAEHAW8ABwIHbwAEAwADBABtAAAAbgYBAgMDAlIGAQICA1YFAQMCA0o0MzIxMC8uLSwrKikZGBMIBRUrJRYdASE1Njc+ATU0JicuASc0Nj8BJicmNjIWDwEWFQ4DBw4BFRQWJTMVIxUjNSM1MzUzAmy0/OAkLl5GLggCKgQKBAQIBAZc5FwEDhICDg4OAgouSAFElpZklpZkgEA6asoODCJGPBY0MAwaMBAUAgQyJjZ0dDZYCCIcHgQMDC42FjxG7mSWlmSWAAAAAAIAAP9qA+gCwwAXAD0APkA7NAgCAQAmCwIDAgJHAAMCA3AABAUBAAEEAGAAAQICAVQAAQECWAACAQJMAQA7OiQiHRsSEAAXARcGBRQrASIOAQcUFh8BBwYHNj8BFxYzMj4CLgEBFA4BIyInBgcGByMiJic1JjYmPwE2PwE+Aj8BLgEnND4BIB4BAfRyxnQBUEkwDw0aVUUYICYicsZ0AnjCAYCG5ognKm6TGyQDCA4CAgQCAwwEDRQHFBAHD1hkAYbmARDmhgJ8ToRMPnIpHDUzLiQ8FQMFToSYhE7+4mGkYARhJggEDAkBAggEAw8FDhYIHBwTKjKSVGGkYGCkAAADAAD/sAPoAsMAFQA7AGAAVkBTXAwIAwEANQkCAwFSAQUDA0cjAQUBRkUBBEQHAQIGAQABAgBgAAEAAwUBA2AABQQEBVQABQUEWAAEBQRMFxYBAFVTUU8eHBY7FzsQDgAVARUIBRQrASIOAQcUFh8BBzY/ARcWMzI+ATQuAScyHgIOASciJwYHBgcjIiY1JjQ2NT8CNgc3PgI3LgEnND4BAR4BHwEWHwMUBw4BJyYnJicGIyInFjMyNjc+ASc0Jx4BFAYBiVWWVgE8NTYTEw8ZHisqVZZWVpZVarZoAmyybDAyRlUVGwIGDAECAQQDAwEcBQ4OBEVOAWq0AjYFDAgbCQQFBAMBAgoHHBRWRjIwl3AgEVqkQkVMAQ1IVFACfDpkOS1WHiAuCwoSBgg6ZHBmOEhMhJyCTgEJMRcFBAoHAQQEAQMGAwMBHgUYEhAodENOhEz9dA4WCiELAwUGCgECCAoBBAUXMQlKAzIvNIZKKyoneId2AAAAAwAA/2oDxANTAAwAGgBCALFADAABAgABRygbAgMBRkuwDlBYQCgHAQUBAAEFZQAAAgEAYwADAAEFAwFgAAIABgIGXAAEBAhYAAgIDARJG0uwJFBYQCkHAQUBAAEFZQAAAgEAAmsAAwABBQMBYAACAAYCBlwABAQIWAAICAwESRtALwcBBQEAAQVlAAACAQACawAIAAQDCARgAAMAAQUDAWAAAgYGAlQAAgIGWAAGAgZMWVlADB8iEigWESMTEgkFHSsFNCMiJjc0IhUUFjcyJSEmETQuAiIOAhUQBRQGKwEUBiImNSMiJjU+BDc0NjcmNTQ+ARYVFAceARcUHgMB/QkhMAESOigJ/owC1pUaNFJsUjQaAqYqHfpUdlT6HSocLjAkEgKEaQUgLCAFaoIBFiIwMGAIMCEJCSk6AamoASkcPDgiIjg8HP7XqB0qO1RUOyodGDJUXohNVJIQCgsXHgIiFQsKEJJUToZgUjQAAAACAAD/ygOhA0AACQApACdAJBwZFA4NCQgHBgUDAQwAAgFHAAIAAm8BAQAAZiUkFxYSEAMFFCsBNy8BDwEXBzcXExQPARMVFCMiLwEHBiImNTQ3EycmNTQ3JTc2Mh8BBRYCe6rramnsqynT0/4PyjAXCgz7+gwWDAEwyw4fARh+CyAMfQEYIAEipiLV1SKm629vAbIMD8X+6QwcB4SEBxIKBAgBF8UPDBUFKP4XF/4oBQAAAAACAAAAAAI6AcwACAARAC1AKgUCBAMAAQEAVAUCBAMAAAFYAwEBAAFMCgkBAA4NCREKEQUEAAgBCAYFFCsTMhYUBiImNDYhMhYUBiImNDZuLkBAXEBAAYwuQEJaQEABzEBaQkBcQEBaQkBcQAADAAAAAAOYAcwACAARABoAOkA3CAQHAgYFAAEBAFQIBAcCBgUAAAFYBQMCAQABTBMSCgkBABcWEhoTGg4NCREKEQUEAAgBCAkFFCsTMhYUBiImNDYhMhYUBiImNDYhMhYUBiImNDZuLkBAXEBAAYwuQEJYQkABjC5AQFxAQAHMQFpCQlpAQFpCQlpAQFpCQlpAAAAAAf/z/3wCUwM0ABoAGEAVGQ4JBwQARAEBAABmAAAAGgAaAgUUKwEUHgIHBicmNzYuAicRFgYHBi4BNjc2FxEBfVxYIjgUBgICCggSRDACTkJKiihQTFZIAzQqblqUUCISBgoSTFBCCP3oMF4YHChwdhoeGgKMAAAACf/T/68DKwMNAAgAEQA6AD4AQgBGAEoATgBSAINAgE5LSEQuBQUNAUcACAAHBAgHYAAEEBQMAwkKBAleFRELAwoPDgINBQoNXgAFAAYABQZgEwISAwABAQBUEwISAwAAAVgDAQEAAUxPTz8/CgkBAE9ST1JRUE1MSklGRT9CP0JBQD49PDs3NDEvJyQhHhQSDg0JEQoRBQQACAEIFgUUKzcyFhQGIiY0NiEyFhQGIiY0NgEhMhYdARQGBwUOARYzITIWFAYjISInLgE3Nj8BAyMiJjQ2OwEyFxYXBSMXMyUXMycHNycjFzcnIwU1Ixc3NSMXiyItLUIuLgIyISwsQi4u/kMCNRscGhT+BxQRERcB3hMWFhP+GCgdGxUKCx8rm0wVFxcVWR8QCw0BeIIbe/60J34cHGQhd8NxGXcBKoUUcaITTC5BLi5BLi5CLS5BLgJMHBbpFBwCOQIdGxgiGBQTPB8gFyEBUxskGw8KHYVVVVVV8QplYAtVQ0NOe1VVAAAAAAH/9v94AuYDPgAZAAazEwEBLSsTJREWBgcGLgE2NzYXEQURFAYHBi4BNjc2F84CFgJANkBcIjI8NDb+nkA2QFoiMDw2NgLKdP1AKk4UGCBgYhgUCgF4Uv4WKk4UFh5gYhgUCgABAAD/nAMgAyAAJwBEQEEhAQUEFAsCAgMmBwIBAANHAAQFBG8ABQMFbwADAgNvAAIAAm8GAQABAG8AAQFmAQAgHhsaExEODAUEACcBJwcFFCslMhYUBiImNTQ2NSUGIyImNDYzMhclNCY1NDYyFhQGIyInBRYUBwU2Aoo+WFh8WAL+/CoyPlhYPjYmAQQCWHxYWD40Jv76AgIBBiTIVn5YWD4GEAScIFh8WB6cBBAEPlhWflggnAgiCJweAAMAAP9qA1kDUgATABoAIwBgtRQBAgQBR0uwIVBYQBsAAgADBQIDYAYBBQAABQBcAAQEAVgAAQEMBEkbQCIAAQAEAgEEXgACAAMFAgNgBgEFAAAFUgYBBQUAWAAABQBMWUAOGxsbIxsjEyYUNTYHBRkrAR4BFREUBgchIiYnETQ2NyEyFhcHFTMmLwEmExEjIiYnNSERAzMQFh4X/RIXHgEgFgH0FjYPStIFB68GxugXHgH+UwJ+EDQY/X4XHgEgFgN8Fx4BFhAm0hEGrwf8sAI8IBXp/KYAAAYAAP9qA1kDUgATABoAIwAzAEMAUwC4QBUUAQIELCQCBwZAOAIICVBIAgoLBEdLsCFQWEA1AAIAAwYCA2AABgAHCQYHYA0BCQAICwkIYA4BCwAKBQsKYAwBBQAABQBcAAQEAVgAAQEMBEkbQDwAAQAEAgEEXgACAAMGAgNgAAYABwkGB2ANAQkACAsJCGAOAQsACgULCmAMAQUAAAVSDAEFBQBYAAAFAExZQCJERDQ0GxtEU0RSTEo0QzRCPDowLigmGyMbIxMmFDU2DwUZKwEeARURFAYHISImJxE0NjchMhYXBxUzJi8BJhMRIyImJzUhERM0NjMhMhYdARQGIyEiJjUFMhYdARQGIyEiJj0BNDYzBTIWHQEUBiMhIiY9ATQ2MwMzEBYeF/0SFx4BIBYB9BY2D0rSBQevBsboFx4B/lOPCggBiQgKCgj+dwgKAZsICgoI/ncICgoIAYkICgoI/ncICgoIAn4QNBj9fhceASAWA3wXHgEWECbSEQavB/ywAjwgFen8pgHjBwoKByQICgoIWQoIJAgKCggkCAqPCggkCAoKCCQICgAACAAA/2oDWQNSABMAGgAjAFkAXgBtAHgAfwC5QCAUAQIEbWoCAwJ1YVZJBAYDcCYCCgZ/NAILClwBCAcGR0uwIVBYQDQACAcFBwgFbQkBAgADBgIDYAAGAAoLBgpgAAsABwgLB2AMAQUAAAUAXAAEBAFYAAEBDARJG0A7AAgHBQcIBW0AAQAEAgEEXgkBAgADBgIDYAAGAAoLBgpgAAsABwgLB2AMAQUAAAVSDAEFBQBYAAAFAExZQBobG318e3pQTTg3MjApJxsjGyMTJhQ1Ng0FGSsBHgEVERQGByEiJicRNDY3ITIWFwcVMyYvASYTESMiJic1IREBFhc2MzIXFgcUIwcGIyImJwYHBiMiLwImNz4BNzYXFhU2NzY3LgE3NjsBMhcWBwYHFQYHFgE2Nw4BEwYXNjc0NzY3Ij0BJzQnAzY3Ii8BJicGBwYFJiMWMzI3AzMQFh4X/RIXHgEgFgH0FjYPStIFB68GxugXHgH+UwGsEh0hIFIRCQgBAQMkG0oke2BVMggHDgMGAgU2LggFAR0fJhQNCAgGEQwNBwoFAQEBBx/+8h0vHSjXCQcBAwQBAgEBB0ZMUwEGCSscDx8RAWANQSobCAICfhA0GP1+Fx4BIBYDfBceARYQJtIRBq8H/LACPCAV6fymAUsOEQQbDRABAhUWEg0hkgQHAgYOFzgaBQgBAS8/TEYuVhwWCAwaAwEWRCdb/vENSxYyAfEXMgQUAhYDAgEBAQwI/o0eDwUIJT0wPh8GDRABAAAABAAA/2oDWQNSABMAGgAjAFEA9UALFAECBEo+AgcGAkdLsBJQWEA2EA4MAwoDBgMKZQ0LCQMGBwMGB2sIAQcFBQdjAAIAAwoCA2APAQUAAAUAXQAEBAFYAAEBDARJG0uwIVBYQDgQDgwDCgMGAwoGbQ0LCQMGBwMGB2sIAQcFAwcFawACAAMKAgNgDwEFAAAFAF0ABAQBWAABAQwESRtAPxAODAMKAwYDCgZtDQsJAwYHAwYHawgBBwUDBwVrAAEABAIBBF4AAgADCgIDYA8BBQAABVIPAQUFAFkAAAUATVlZQCQkJBsbJFEkUVBPRUQ6OTg3NjU0MygnJiUbIxsjEyYUNTYRBRkrAR4BFREUBgchIiYnETQ2NyEyFhcHFTMmLwEmExEjIiYnNSERExUzEzMTNjc2NTMXHgEXEzMTMzUjFTMHBg8BIycuAScDIwMHBg8BIycmLwEzNQMzEBYeF/0SFx4BIBYB9BY2D0rSBQevBsboFx4B/lM7J1xYSAQBAgIBAQICSFlbJ6cyNwMBAQMBAQICUT9RAgEBAgICAQI4MgJ+EDQY/X4XHgEgFgN8Fx4BFhAm0hEGrwf8sAI8IBXp/KYB9Dv+jwEPCw4JBQ4BFAT+8QFxOzv1Cw4MDAISBQEw/tANCAQMDA4L9TsAAAQAAP9qA1kDUgATABoAIwBTARZACxQBAgRSOwIHCwJHS7ASUFhAPw8BDAMLAwxlEA4NAwsHAwsHaxMRCggEBwYDBwZrCQEGBQUGYwACAAMMAgNgEgEFAAAFAF0ABAQBWAABAQwESRtLsCFQWEBBDwEMAwsDDAttEA4NAwsHAwsHaxMRCggEBwYDBwZrCQEGBQMGBWsAAgADDAIDYBIBBQAABQBdAAQEAVgAAQEMBEkbQEgPAQwDCwMMC20QDg0DCwcDCwdrExEKCAQHBgMHBmsJAQYFAwYFawABAAQCAQReAAIAAwwCA2ASAQUAAAVSEgEFBQBZAAAFAE1ZWUAqJCQbGyRTJFNRUE9OTUxBQD8+PTw6OTg3NjUoJyYlGyMbIxMmFDU2FAUZKwEeARURFAYHISImJxE0NjchMhYXBxUzJi8BJhMRIyImJzUhETcVMzUjNz4CBzMUHwEeAR8BIxUzNSMnNzM1IxUzBw4BDwEjNCcmLwEzNSMVMxcHAzMQFh4X/RIXHgEgFgH0FjYPStIFB68GxugXHgH+U6idKjoDBAYBAQMCAQQCPCujJmtsJpwpOQIIAQEBAwMGOyqiJmptAn4QNBj9fhceASAWA3wXHgEWECbSEQavB/ywAjwgFen8poM7O1oECgYBAgQEAgQDWjs7mJ47O1kECgMBAgMGB1k7O5ieAAAFAAD/agNZA1IAEwAaACMANwBCAa21FAECBAFHS7AKUFhARAAJAwoDCQptAAoNAwoNawAGBwUFBmUAAgADCQIDYAANEAEMCA0MYAAIDwsCBwYIB14OAQUAAAUAXQAEBAFYAAEBDARJG0uwC1BYQD4ACQMKAwkKbQAGBwUFBmUAAgADCQIDYA0BChABDAgKDGAACA8LAgcGCAdeDgEFAAAFAF0ABAQBWAABAQwESRtLsBJQWEBEAAkDCgMJCm0ACg0DCg1rAAYHBQUGZQACAAMJAgNgAA0QAQwIDQxgAAgPCwIHBggHXg4BBQAABQBdAAQEAVgAAQEMBEkbS7AhUFhARQAJAwoDCQptAAoNAwoNawAGBwUHBgVtAAIAAwkCA2AADRABDAgNDGAACA8LAgcGCAdeDgEFAAAFAF0ABAQBWAABAQwESRtATAAJAwoDCQptAAoNAwoNawAGBwUHBgVtAAEABAIBBF4AAgADCQIDYAANEAEMCA0MYAAIDwsCBwYIB14OAQUAAAVSDgEFBQBZAAAFAE1ZWVlZQCY5OCQkGxs8OjhCOUIkNyQ3NjU0MispKCcmJRsjGyMTJhQ1NhEFGSsBHgEVERQGByEiJicRNDY3ITIWFwcVMyYvASYTESMiJic1IRE3FTM1IzUzMjc+AS4BJyYrARUzETcjNTMyFxYVFAcGAzMQFh4X/RIXHgEgFgH0FjYPStIFB68GxugXHgH+U6G3NEwrFyUuASojGy3ONJFCQx0RHyISAn4QNBj9fhceASAWA3wXHgEWECbSEQavB/ywAjwgFen8poM7O10JDEhbQhAKO/7KnJYKEy0yEQkABQAA/2oDWQNSABMAGgAjACoAMwCYQBEUAQIEKgEHCCkoJyQEBgcDR0uwIVBYQCwABgcFBwYFbQACAAMIAgNgAAgKAQcGCAdgCQEFAAAFAFwABAQBWAABAQwESRtAMwAGBwUHBgVtAAEABAIBBF4AAgADCAIDYAAICgEHBggHYAkBBQAABVIJAQUFAFgAAAUATFlAGCwrGxswLyszLDMmJRsjGyMTJhQ1NgsFGSsBHgEVERQGByEiJicRNDY3ITIWFwcVMyYvASYTESMiJic1IRElFSE1Nxc3BSImNDYyFhQGAzMQFh4X/RIXHgEgFgH0FjYPStIFB68GxugXHgH+UwKD/cVrR9f+4i0+Plo+PgJ+EDQY/X4XHgEgFgN8Fx4BFhAm0hEGrwf8sAI8IBXp/Kb6smtrR9ZHPlo+Plo+AAAJAAD/agNZA1IAAwAHAAsADwAjACoANwBKAFMB4UALJAEADAFHRAESAUZLsAlQWEBZDQEADAIMAGUAAgEMAmMXAQUGBwYFB20RGAIHEgYHEmsVAQEABAMBBF4KFgIDCwEGBQMGYAASABQTEhRgGgETABAPExBgGQEPAAgPCFwOAQwMCVgACQkMDEkbS7ASUFhAWg0BAAwCDABlAAIBDAIBaxcBBQYHBgUHbREYAgcSBgcSaxUBAQAEAwEEXgoWAgMLAQYFAwZgABIAFBMSFGAaARMAEA8TEGAZAQ8ACA8IXA4BDAwJWAAJCQwMSRtLsCFQWEBbDQEADAIMAAJtAAIBDAIBaxcBBQYHBgUHbREYAgcSBgcSaxUBAQAEAwEEXgoWAgMLAQYFAwZgABIAFBMSFGAaARMAEA8TEGAZAQ8ACA8IXA4BDAwJWAAJCQwMSRtAYg0BAAwCDAACbQACAQwCAWsXAQUGBwYFB20RGAIHEgYHEmsACQ4BDAAJDF4VAQEABAMBBF4KFgIDCwEGBQMGYAASABQTEhRgGgETABAPExBgGQEPCAgPUhkBDw8IWAAIDwhMWVlZQERMSysrDAwICAQEAABQT0tTTFNJR0ZFPj0rNys3NjU0MzIxLiwmJSEeGRYMDwwPDg0ICwgLCgkEBwQHBgUAAwADERsFFSsBNSMVFzUjHQE1IxUXNSMVJR4BFREUBgchIiYnETQ2NyEyFhcHFTMmLwEmExEjIiYnNSMVIzUhEQEXFhUUBi4BJzQ3Njc1MxUzMhYDMjY0JiIOARYBZUePSEePSAHOEBYeF/0SFx4BIBYB9BY2D0rSBQevBsboFx4BR0j+4gFtPARQfk4CBQw3RywNEkseKio8KAIsAnxHR0hISEdHR0hISNkQNBj9fhceASAWA3wXHgEWECbSEQavB/ywAjwgFelISPymAZPDDw4uPgI6MA4PI7pHRw7+8BYcFhYcFgAGAAD/agNZA1IAEwAaACMAOQBLAFwBQEAKFAECBDMBBgcCR0uwCVBYQDoACgMHAwoHbQ0BCQYIBQllDAEIBQUIYwACAAMKAgNgAAcABgkHBl4LAQUAAAUAXQAEBAFYAAEBDARJG0uwElBYQDsACgMHAwoHbQ0BCQYIBgkIbQwBCAUFCGMAAgADCgIDYAAHAAYJBwZeCwEFAAAFAF0ABAQBWAABAQwESRtLsCFQWEA8AAoDBwMKB20NAQkGCAYJCG0MAQgFBggFawACAAMKAgNgAAcABgkHBl4LAQUAAAUAXQAEBAFYAAEBDARJG0BDAAoDBwMKB20NAQkGCAYJCG0MAQgFBggFawABAAQCAQReAAIAAwoCA2AABwAGCQcGXgsBBQAABVILAQUFAFkAAAUATVlZWUAgTUw7OhsbU1JMXE1cOks7Szc1Ly4bIxsjEyYUNTYOBRkrAR4BFREUBgchIiYnETQ2NyEyFhcHFTMmLwEmExEjIiYnNSERARYVERQHBiMiLwEjIiY9ATQ2OwE3NhMyNzY0Jy4BDgEXFhQHBhYXFicyNzY0Jy4BBhQXFhQHBhQWAzMQFh4X/RIXHgEgFgH0FjYPStIFB68GxugXHgH+UwETCwsEAwYGXUkICgoISV0I9BELSEgJHhcECjg4CQIMCmkPCzExCh4WCh0dChcCfhA0GP1+Fx4BIBYDfBceARYQJtIRBq8H/LACPCAV6fymAccFDP7QDAQBBV0KCGsICl0I/nsOWORZCwQTHgtFskQMHggJUws0jDQLAhYcDCBSIAseEwAFAAD/agNZA1IAEwAaACMAMwBDAJJACxQBAgQ/PgIHBgJHS7AhUFhALAgKAgYDBwMGB20ABwUDBwVrAAIAAwYCA2AJAQUAAAUAXAAEBAFYAAEBDARJG0AzCAoCBgMHAwYHbQAHBQMHBWsAAQAEAgEEXgACAAMGAgNgCQEFAAAFUgkBBQUAWAAABQBMWUAYJSQbG0NBLSokMyUyGyMbIxMmFDU2CwUZKwEeARURFAYHISImJxE0NjchMhYXBxUzJi8BJhMRIyImJzUhEQEyFh0BFAYHIyImPQE0NjMFFhURFAcGIyIvATU3NjMyAzMQFh4X/RIXHgEgFgH0FjYPStIFB68GxugXHgH+UwFmHSoqHdcdKiodAekLCwQDBwWUlAUHAwJ+EDQY/X4XHgEgFgN8Fx4BFhAm0hEGrwf8sAI8IBXp/KYB9Cod1h0qASwc1h0qAQQM/r4MBQEFlTKUBQAABgAA/2oDWQNSABMAGgAjADcASwBbAIhACxQBAgRDLAIHBgJHS7AhUFhAKgAGAwcDBgdtAAcFAwcFawACAAMGAgNgCAEFAAAFAFwABAQBWAABAQwESRtAMQAGAwcDBgdtAAcFAwcFawABAAQCAQReAAIAAwYCA2AIAQUAAAVSCAEFBQBYAAAFAExZQBIbGzMyJiUbIxsjEyYUNTYJBRkrAR4BFREUBgchIiYnETQ2NyEyFhcHFTMmLwEmExEjIiYnNSEREzYyHwEWFA8BFxYGDwEGIi8BJjchFg8BDgEvAS4BPwEnJjY/ATYWFwMuATcTPgEfAR4BBwMOAScDMxAWHhf9EhceASAWAfQWNg9K0gUHrwbG6BceAf5TxQQQBRwHA2ZmBAIGHAYOBX4ICAI9CAh+BA4HHAYCBGZmBAIGHAYQA9wHCAFNAQwIIwcIAU0BDAcCfhA0GP1+Fx4BIBYDfBceARYQJtIRBq8H/LACPCAV6fymAfQHAxUFDgaIiAYOBRUEB6gLCwsLqAYCBRUFDgaIiAYOBRUEAgb+VwEOBgHQBwgBBQIMB/4wBwgBAAAABgAA/7EDEgMLAA8AHwAvADsAQwBnAGRAYVdFAgYIKSEZEQkBBgABAkcFAwIBBgAGAQBtBAICAAcGAAdrAA4ACQgOCWAPDQIIDAoCBgEIBl4ABwsLB1QABwcLWAALBwtMZWRhXltZU1JPTElHQT8UJBQmJiYmJiMQBR0rAREUBisBIiY1ETQ2OwEyFhcRFAYrASImNRE0NjsBMhYXERQGKwEiJjURNDY7ATIWExEhERQeATMhMj4BATMnJicjBgcFFRQGKwERFAYjISImJxEjIiY9ATQ2OwE3PgE3MzIWHwEzMhYBHgoIJAgKCggkCAqPCggkCAoKCCQICo4KByQICgoIJAcKSP4MCAgCAdACCAj+ifobBAWxBgQB6woINjQl/jAlNAE1CAoKCKwnCSwWshcqCSetCAoBt/6/CAoKCAFBCAoKCP6/CAoKCAFBCAoKCP6/CAoKCAFBCAoK/mQCEf3vDBQKChQCZUEFAQEFUyQICv3vLkRCLgITCggkCApdFRwBHhRdCgAFAAD/sQMSAwsADwAfAC8ANwBbAFhAVUs5AggGKSEZEQkBBgEAAkcADAAHBgwHYAoBCAAGCFQNCwIGBAICAAEGAGAFAwIBCQkBVAUDAgEBCVgACQEJTFlYVVJPTUdGQ0AmIhMmJiYmJiMOBR0rJRE0JisBIgYVERQWOwEyNjcRNCYrASIGFREUFjsBMjY3ETQmKwEiBhURFBY7ATI2ATMnJicjBgcFFRQGKwERFAYjISImJxEjIiY9ATQ2OwE3PgE3MzIWHwEzMhYBHgoIJAgKCggkCAqPCggkCAoKCCQICo4KByQICgoIJAcK/tH6GwQFsQYEAesKCDY0Jf4wJTQBNQgKCgisJwksFrIXKgknrQgKUgGJCAoKCP53CAoKCAGJCAoKCP53CAoKCAGJCAoKCP53CAoKAjJBBQEBBVMkCAr97y5EQi4CEwoIJAgKXRUcAR4UXQoAAAQAAP/5A6EDCwAPAB8ALwA/ACVAIgcBAwIDbwYBAgECbwUBAQABbwQBAABmNTU1NTU1NTMIBRwrARUUBiMhIiY9ATQ2MyEyFhMVFAYHISImPQE0NjchMhYBFRQGIyEiJj0BNDYzITIWExUUBgchIiY9ATQ2NyEyFgGtLBz+4h0qKh0BHh0qASwc/uIdKiodAR4dKgH1LBz+4h0qKh0BHh0qASwc/uIdKiodAR4dKgEX1x0qKh3XHSoqAY/WHSoBLBzWHSoBLP441x0qKh3XHSoqAY/WHSoBLBzWHSoBLAAACQAA//kD6AMLAA8AHwAvAD8ATwBfAG8AfwCPAE9ATBENAgcQDAIGAwcGYA8JAgMOCAICAQMCYAsFAgEAAAFUCwUCAQEAWAoEAgABAEyOi4aDfnt2c25rZmNeW1ZTTks1NTU1NTU1NTMSBR0rJRUUBgcjIiYnNTQ2FzMyFhMVFAYnIyImJzU0NjczMhYBFRQGByMiJic1NDYXMzIWARUUBisBIiYnNTQ2OwEyFgEVFAYnIyImJzU0NjczMhYBFRQGByMiJj0BNDYXMzIWARUUBisBIiYnNTQ2OwEyFgEVFAYnIyImPQE0NjczMhYTFRQGKwEiJj0BNDY7ATIWAR4gFrIXHgEgFrIXHgEgFrIXHgEgFrIXHgFmIBayFx4BIBayFx7+nCAWshceASAWshceAWYgFrIXHgEgFrIXHgFmIBayFiAgFrIXHv6cIBayFx4BIBayFx4BZiAWshYgIBayFx4BIBayFiAgFrIXHppsFh4BIBVsFiABHgEGaxYgAR4XaxceASD+zWwWHgEgFWwWIAEeAiRrFiAgFmsWICD+zGsWIAEeF2sXHgEg/s1sFh4BIBVsFiABHgIkaxYgIBZrFiAg/sxrFiABHhdrFx4BIAEIaxYgIBZrFiAgAAAGAAD/+QPoAwsADwAfAC8APwBPAF8APEA5CwEHCgEGAwcGYAkBAwgBAgEDAmAFAQEAAAFUBQEBAQBYBAEAAQBMXltWU05LNTU1NTU1NTUzDAUdKyUVFAYHIyImJzU0NhczMhYTFRQGJyMiJic1NDY3MzIWARUUBgchIiYnNTQ2FyEyFgEVFAYrASImJzU0NjsBMhYBFRQGJyEiJic1NDY3ITIWExUUBiMhIiYnNTQ2MyEyFgEeIBayFx4BIBayFx4BIBayFx4BIBayFx4CyyAW/ekXHgEgFgIXFx79NyAWshceASAWshceAssgFv3pFx4BIBYCFxceASAW/ekXHgEgFgIXFx6abBYeASAVbBYgAR4BBmsWIAEeF2sXHgEg/s1sFh4BIBVsFiABHgIkaxYgIBZrFiAg/sxrFiABHhdrFx4BIAEIaxYgIBZrFiAgAAABAAD/tgOIAxIAFgAbQBgLAQABAUcOAQFFAAEAAW8AAABmGBwCBRYrATYWBw4CLgIGBxMjAzc+AR4DNgNqDhAIYIhUPjpEdlBaZLhcWnxIOERaqAJoBg4MipYeGjAgKEL+oALQIkIoIkRKMgoAAAAAA//6/7YDxwMIAAwAEAAUADxAOQABBAFvAAQFBG8HAQUAAgMFAl4GAQMAAANSBgEDAwBYAAADAEwREQ0NERQRFBMSDRANEBMVMggFFysFFgYjISInJjcBNjIXEzUjFTcRIxEDvQoUFPyEEgoNCwG+CCwIGm5ubhgQIhASEAMOEhL9JGRkrgEs/tQAAAABAAAAAAH0ApIACwAGswoFAS0rARYUBwEGJjURNDYXAeYODv5UGCIiGAF4Ch4K/vYQFB4CAh4UEAAAAAABAAAAAAJYAooADAAYQBUCAQABAG8AAQFmAQAHBAAMAQsDBRQrATIVERQjISI1ETQ2MwIOSkr+PkwkKAKKQP4qQkIB1iQcAAACAAAAAAISArwACAARACNAIAUCBAMAAQBvAwEBAWYKCQEADg0JEQoRBQQACAEIBgUUKwEyFREUIjURNCEyFREUIjURNAG4WrT+/Fq0ArxA/cZCQgI6QED9xkJCAjpAAAABAAAAAAK8ArwACAAYQBUCAQABAG8AAQFmAQAFBAAIAQgDBRQrATIWEAYgJhA2AV6SzMz+3MzMArzM/t7OzgEizAAAAAIAAAAAAlgCggALABQAGEAVAgEAAQBvAAEBZg0MERAMFA0UAwUUKwEWFAcFBiY1ETQ2FyUyFREUIjURNAGcDg7+lhYcHBYB3EqWAXYKGgrkDhIaAboaEg4oOv4uOjoB0joAAAAE//r/mgPzAxoAKwA3AFYAXgAdQBpZWEA/BABEAgEBAAFvAAAAZh0cGxoREAMFFCsTDgEUIwcGBwYvASY3PgE3NjI+ATcyPgE3NjcyFzIHBgcGFxYXFg8BBicuARcBFg8BBicBJj8BNiUWBwYnJg8BJzc+ASY3Njc2FgcGBwYWFxY3PgE3NhYBNxcHBi8BJpsIBgIRDwQQDEYLDQIgBAYqHggGAg4mFoY0ehoMFHggUCwiBAgKTA4EKjr4AZoSFDAWEP5iCAhIDAIyECAyaDgsUkREGA4CBgyADAwEDCIOBCY6JgYoAgQS/Kj+TPYUEi4WAfoIHBYPDQQOEkwMDAIYBAYcMAYOHhBaBgIINBg4Oi4CCAZGCAQwGDL+JBYQKg4SAdgIDD4IwGg+WBoMLE5ORhg6SBY4OAYSBgxECjIcKD4MOgQKAv1E+FbyFBAuEgACAAAAAAPoAooACwAXAD9APAkBB0UOAQFEAwECBgQGAgRtBQEEAAYEAGsABwAGAgcGXgAAAQEAUgAAAAFYAAEAAUwhERIREhMhEAgFHCs3IRchIiY1ESM3FyMFMwcnMxEhJyEyFhX6ARCA/kAqOmawrmQCimSusGb+7oABwig8vow8KAEuxsbKyMgBBIw6KgACAAAAAAJYAoIADAAUABFADgAAAQBvAAEBZhMeAgUWKxM0NyU2FhURFAYnJSYnNDIVERQiNa4OAWwUHBwU/pQOrpaWAV4OCuQOEhr+RhoSDuQK9jo6/i46OgAAAAIAAAAAA3ACfAALABcACLUWEQoFAi0rARYUBwUGJjURNDYXBxYUBwUGJjURNDYXA2IODv6MFh4eFlIODv6YFCAgFAF2ChwI+A4QHAHiHBAO+AocCPgOEBwB4hwQDgAAAAIAAAAAA3ACfAAMABkACLUWEQkEAi0rETQ3JTYWFREUBiclJiU0NyU2FhURFAYnJSYOAXYUICAU/ooOAcYOAWgUICAU/pgOAV4OCvgOEBz+HhwQDvgIDg4K+A4QHP4eHBAO+AgAAAAAAgAA/2oD6ANSABwAKQBfQBECAQAEGhkYAwIAAkccGwICREuwJFBYQBQFAwIAAAIAAlwABAQBWAABAQwESRtAHAABAAQAAQRgBQMCAAICAFQFAwIAAAJYAAIAAkxZQA4eHSQjHSkeKSkZEAYFFyslIyc+ATU0JyYnJiIHBgcGFBcWFxYzMjY3FxUBNwEiLgE0PgEyHgEUDgECyi0SLDAzMVRXyldUMTIzMVRWZUV8LxIBHVb9i0Z2RUV2jHZGRXfdEi98RWVWVDEzMzFUVspXVDEzMCwSLf7iVgEdRXeMdkVFdox2RgAAAAIAAAAAAxACoAACAAUACLUFAwIAAi0rJQkBFw0BATwB1P4sRgET/u0cAUIBQoW9vQAAAAADAAD/+QMTAwsACAAgADkANkAzKAkCAAEBRwADBQEFAwFtAAYABQMGBWAAAQAAAVQAAQEAWAQCAgABAEw2FjgcNBMSBwUbKzcUBiImNDYyFgUWBisBIiYnLgEnLgE9ATQ3NjsBHgMFFgYrASImNy4DJy4BPQE0NjsBFgQWEtY+Wj4+Wj4BHgEUEUsOFAEMtoAOEgwJDwNZon9MASUBFRBQDhYBB2Se2nYOFBUPAZMBCtF4ZC0+Plo+PnIPFxIOgLYMARQOSxAKCgdMfqRaDxYUDXjYoGIIARQOUBAUCHbR/vQAAAABAAD/zwODAwsAHgAgQB0YDwIAAQFHAAIBAm8DAQEAAW8AAABmFTUXFAQFGCsBFAcBBiInASY0PwE2Mh8BETQ2NzMyFhURNzYyHwEWA4MV/pUWOhX+lRUVKRY6FaQqHkcdKqUUOxYpFQGCHhT+lBUVAWwUOxYpFRWkAYkdKgEsHP53pBUVKRYAAQAA/4gDWQLtAB0AJEAhAAIDAm8AAQABcAADAAADVAADAwBYAAADAEwmFxYjBAUYKwEVFAYjIRcWFA8BBiInASY0NwE2Mh8BFhQPASEyFgNZJB3+d6QVFSoVOxX+lBQUAWwVOhYqFRWkAYkdJAFeRx4qpBQ8FCsUFAFsFToWAWsVFSkWOhakKAAAAAABAAD/iAM1Au0AHgAkQCEAAwIDbwAAAQBwAAIBAQJUAAICAVgAAQIBTBYlJhQEBRgrARQHAQYiLwEmND8BISImPQE0NhchJyY0PwE2MhcBFgM1FP6VFjoVKhYWo/53HSQkHQGJoxYWKhU6FgFrFAE6HhT+lBQUKhU8FaMqHkceKgGlFDwUKhUV/pUUAAEAAP+xA4MC5wAeACBAHRAHAgADAUcAAwADbwIBAAEAbwABAWYXFTUUBAUYKwEUDwEGIi8BERQGByMiJjURBwYiLwEmNDcBNjIXARYDgxUpFjsUpSgfRx4qpBQ8FCoVFQFrFDwVAWsVATQcFioVFaT+dx0kASYcAYmkFRUqFTsVAWsVFf6VFgABAAD/nwMfAx0ADAAjQCAJBwIBAAFHCAEBRAIBAAEAbwABAWYBAAYEAAwBDAMFFCsBMhYQBiciJwc3JhA2AZmi5OSiKjK7AXHmAx3k/rzmAQx95XMBQuQAAQAA/2kD6ALDACYAHEAZGwEAAQFHDQEARAABAAFvAAAAZiQiIwIFFSsBFA4BIyInBgcGBwYmJzUmNiY/ATY/AT4CPwEuASc0PgIzMh4BA+iG5ognKm6TGyQKDgMCBAIDDAQNFAcUEAcPWGQBUIS8ZIjmhgFeYaRgBGEmCAQBDAoBAggEAw8FDhYIHBwTKjKSVEmEYDhgpAAD////+AOpAsQAGQAmADAAM0AwAAUDBAMFBG0ABAIDBAJrAAAAAwUAA2AAAgEBAlQAAgIBWAABAgFMFBUVGRwWBgUaKxE0PgQeBRcUDgUuBDcUHgEyPgEuAg4CFxQWPgE3NCYiBh46UmaAin5oUDwcAR46UmaAiIJkVDgg60BqgmhCAj5sfm48hjpSOAE6UDwBXh5KUEw8JgIiQEhURiAeSlBMPCQCKDhQTE4cQGpAQGqAakIEOnI8KToCNispOjoAAAAABAAA/8UDJgLxAA8AEwAzADwAwEASBQECATEBBwQZAQUGDQEAAwRHS7AbUFhAOw4BCgULBQoLbQALAwMLYwABAAIEAQJeDQEEAAcGBAdeCAEGCQEFCgYFYAADAAADUgADAwBZDAEAAwBNG0A8DgEKBQsFCgttAAsDBQsDawABAAIEAQJeDQEEAAcGBAdeCAEGCQEFCgYFYAADAAADUgADAwBZDAEAAwBNWUAnNTQVFAEAOTg0PDU8LSsnJiUkIyEdGxQzFTMTEhEQCQcADwEPDwUUKxchMjY1ETQmIyEiBhURFBYTIREhASEiBhURFBY7ATI2NCYrAREhESMiBhQWOwEyNjURNCYDMhYUBiImNDbAAlcGCQkG/akHCQkWAjj9yAH4/ksHCQkHtAYJCQakAZacBwkJB6sHCQnjDRERGhAROwkHAwwHCQkH/PQHCQMN/RMCoQkG/iQHCQkOCAG9/kMJDAoJBwHcBgn9yRIYEREYEgAAAwAA/2wD6ANQAC0AMQBBAOi2JyACCQ4BR0uwElBYQDgKAQgJCQhkBAECAAMAAgNeBgEAEQ8MCwQHDQAHXgANABAODRBeAA4ACQgOCV4ABQUBWAABAQwFSRtLsB9QWEA3CgEICQhwBAECAAMAAgNeBgEAEQ8MCwQHDQAHXgANABAODRBeAA4ACQgOCV4ABQUBWAABAQwFSRtAPAoBCAkIcAABAAUCAQVgBAECAAMAAgNeBgEAEQ8MCwQHDQAHXgANABAODRBeAA4JCQ5UAA4OCVYACQ4JSllZQB5BQD8+PTw4NTEwLy4tLCYlJCMWERQUEREUFBASBR0rASMRNC4BIg4BHQEjFTM1IzU0PgEyHgEVESEVMxUUHgEXFTM1IRUzNT4CPQEzITMVIyUUDgEjISIuAT0BMxUhNTMD6CswUmBRMEC+QB81PjYf/IEsOWQ8PgFiPjxkOiv9rr29AekyVjP+YDNWMu8BOO8BVwFHMFIwMFIwGD09GB82Hx82H/65Pmw+bEYHSkhISgdGbD5sghYzVjIyVjNswMAAAAkAAP9qA+gDUgB4AIAA5QDvAPgBAQEKARMBHQaCS7AKUFhAieQOBwMCAePcDwMbAhYBAxvbAR0D0xcCGh0eAQQc5dICHgQfARkQJgEFH8qIdgMgBYlvJwMYES4BBiHCkG4DDgaRZy8DFxK6mGY2BA0jmV8CFhOyoF4DDCWhVwInFKhWAgsnfwEVC7CpT04EChWxR0IDCQoWR8sBEMMBEbsBErMBEzsBJ4ABCgZGG0uwC1BYQInkDgcDAgHj3A8DGwIWAQMb2wEdA9MXAhodHgEEHOXSAh4EHwEZECYBBR/KiHYDIAWJbycDGBEuAQYhwpBuAw4GkWcvAxcSuphmNgQNF5lfAhYTsqBeAwwWoVcCJxSoVgILJ38BFQuwqU9OBAoVsUdCAwkKFkfLARDDARG7ARKzARM7ASeAAQoGRhtAieQOBwMCAePcDwMbAhYBAxvbAR0D0xcCGh0eAQQc5dICHgQfARkQJgEFH8qIdgMgBYlvJwMYES4BBiHCkG4DDgaRZy8DFxK6mGY2BA0jmV8CFhOyoF4DDCWhVwInFKhWAgsnfwEVC7CpT04EChWxR0IDCQoWR8sBEMMBEbsBErMBEzsBJ4ABCgZGWVlLsApQWED/AAEAAgABAm0AAhsAAhtrABsDABsDawADHQADHWsAGh0cHRocbQAEHB4cBB5tABAeGR4QGW0AGR8eGR9rAAUfIB8FIG0AESAYIBEYbQAYISAYIWsABiEOIQYObQAOIiEOImsAEiIXIhIXbQAXIyIXI2sADSMkIw0kbQATJBYkExZtABYlJBYlawAMJSYlDCZtABQmJyYUJ20ACycVJwsVbQAVCicVCmsACgknCglrAAkIJwkIawAIDycID2sAHSgBHAQdHGApAR4AHwUeH2AqASAAIQYgIWArASIAIw0iI2AsASQAJQwkJWAtASYAJwsmJ2AADwAHDwdcAAAADABJG0uwC1BYQPMAAQACAAECbQACGwACG2sAGwMAGwNrAAMdAAMdawAaHRwdGhxtAAQcHhwEHm0AEB4ZHhAZbQAZHx4ZH2sABR8gHwUgbQARIBggERhtABghIBghawAGIQ4hBg5tAA4iIQ4iawASIhciEhdtAA0XJBcNJG0AEyQWJBMWbQAMFiYWDCZtABQmJyYUJ20ACycVJwsVbQAVCicVCmsACgknCglrAAkIJwkIawAIDycID2sAHSgBHAQdHGApAR4AHwUeH2AqASAAIQYgIWArASIjARcNIhdgLAEkJQEWDCQWYC0BJgAnCyYnYAAPAAcPB1wAAAAMAEkbS7AkUFhA/wABAAIAAQJtAAIbAAIbawAbAwAbA2sAAx0AAx1rABodHB0aHG0ABBweHAQebQAQHhkeEBltABkfHhkfawAFHyAfBSBtABEgGCARGG0AGCEgGCFrAAYhDiEGDm0ADiIhDiJrABIiFyISF20AFyMiFyNrAA0jJCMNJG0AEyQWJBMWbQAWJSQWJWsADCUmJQwmbQAUJicmFCdtAAsnFScLFW0AFQonFQprAAoJJwoJawAJCCcJCGsACA8nCA9rAB0oARwEHRxgKQEeAB8FHh9gKgEgACEGICFgKwEiACMNIiNgLAEkACUMJCVgLQEmACcLJidgAA8ABw8HXAAAAAwASRtA/gAAAQBvAAECAW8AAhsCbwAbAxtvAAMdA28AGh0cHRocbQAEHB4cBB5tABAeGR4QGW0AGR8eGR9rAAUfIB8FIG0AESAYIBEYbQAYISAYIWsABiEOIQYObQAOIiEOImsAEiIXIhIXbQAXIyIXI2sADSMkIw0kbQATJBYkExZtABYlJBYlawAMJSYlDCZtABQmJyYUJ20ACycVJwsVbQAVCicVCmsACgknCglrAAkIJwkIawAIDycID2sAHSgBHAQdHGApAR4AHwUeH2AqASAAIQYgIWArASIAIw0iI2AsASQAJQwkJWAtASYAJwsmJ2AADwcHD1QADw8HWAAHDwdMWVlZQWIBFQEUAQwBCwEDAQIA+gD5APEA8ADnAOYBGQEYARQBHQEVAR0BEAEPAQsBEwEMARMBBwEGAQIBCgEDAQoA/gD9APkBAQD6AQEA9QD0APAA+ADxAPgA6wDqAOYA7wDnAO8A3wDeANYA1QDOAM0AxgDFAL4AvQC2ALUArACrAKQAowCcAJsAlACTAIwAiwCEAIMAewB6AHIAcQBqAGkAYgBhAFoAWQBSAFEASgBJABQAHQAXABcAFwAXABcAFAAUAC4ABQAdKwE0LwEmIg8BJyYiBhQfAQcnJiIGFB8BBycmIgYUHwEHJyYiBhQfAQcnJiIGFB8BBycmIgYUHwEHBhQfAQEGFBYyNwEXFjI/ARcWMjY0LwE3FxYyNjQvATcXFjI2NC8BNxcWMjY0LwE3FxYyNjQvATcXFjI2NC8BNzYBBiImNDcBFwEnJiIGFB8BBycmIgYUHwEHJyYiBhQfAQcnJiIGFB8BBycmIgYUHwEHJyYiBhQfAQcnNxcWMjY0LwE3FxYyNjQvATcXFjI2NC8BNxcWMjY0LwE3FxYyNzY0LwE3FxYyNjQvATcXJzI2NCYiBhQXFgciBhQWMjY0JgciBhQWMjY0JgciBhQWMjY0JgciBhQWMjY0JgciBhQWMjY0JyYD6AfHBxIHMiAEDwkEICcgBQ4KBSAnIAUOCgUgJyAFDgoFICcgBQ4KBSAnIQQPCQQhMQcHJ/6uGTJIGAFSJwcTBjEkBQ4KBSQoIwcMCgUjJyMFDwkFIycjBQ8JBSMnJAQPCgUkJyQFDAwFJDEH/IoMIRgMAVI5AcwNBA8JBA0nDQUOCgUNJw0FDgoFDScNBQ4KBQ0nDQUOCgUNJw0FDgoFDSKnIRAFDgoFECcQBQ4KBRAnEAUPCQUQJxAFDwkFECcRBQwHBQURJxEFDAwFESKngQcKCQ8KBQc6BwoKDgoKRgcKCg4KCkYHCgoOCgpGBwoKDgoKRgcKCQ8KBQcCdAkHxwcHMSEFCg4FIScgBQkPBSAnIAUJDwUgJyAFCg4FICcgBQoOBSAnIAUKDgUgMgYTByf+rhlHMhkBUicHBzEkBQoPBCQnJAUKDwQkJyMFCg4FIycjBQoOBSMnIwUKDgUjJyMFCg4FIzIG/TkMGCEMAVI5AV0NBQkPBQ0nDQUKDgUNJw0FCQ8FDScNBQoOBQ0nDQUKDgUNJw0FCg4FDSGnIhEFCg8EEScRBQoPBBEnEAUKDgUQJxAFCg4FECcQBQUFDgUQJxAFCg4FECGnFQwMCgoMBwUdCg4KCg4KPwoOCgoOCj8KDgoKDgo/Cg4KCg4KPwoPCQoMBwUAAAAMAAD/0QPBAvwAFAAnAEoAbgB7AH4AjgCSAK8AvADvAPwE+0uwClBYQDTXz8fBraWfBxQVhAEQDxgBAQN+AQcBeWsCDAdkAQkMXwEFCVxZIh8EAAWMAQ4R5QEfGwpHG0uwC1BYQDTXz8fBraWfBxIVhAEQDxgBAQN+AQcBeWsCDAdkAQkMXwEFCVxZIh8EAAWMAQ4R5QEfGwpHG0A018/Hwa2lnwcUFYQBEA8YAQEDfgEHAXlrAgwHZAEJDF8BBQlcWSIfBAAFjAEOEeUBHxsKR1lZS7AJUFhAhQAUFRIVFBJtHRkoAxIWFRIWawYBAhADEAJlJQsjAwMBDANjAAEHEAEHaw0BBwwQBwxrCAEFCQARBWUkBCIDABERAGMeKRgDExwaAhUUExVgIQEWIAEXDxYXYAAPABACDxBeJgEMCgEJBQwJYQARJwEOGxEOYQAbHx8bUgAbGx9YAB8bH0wbS7AKUFhAhgAUFRIVFBJtHRkoAxIWFRIWawYBAhADEAJlJQsjAwMBEAMBawABBxABB2sNAQcMEAcMawgBBQkAEQVlJAQiAwAREQBjHikYAxMcGgIVFBMVYCEBFiABFw8WF2AADwAQAg8QXiYBDAoBCQUMCWEAEScBDhsRDmEAGx8fG1IAGxsfWAAfGx9MG0uwC1BYQIAdGRQoBBIVFhUSFm0GAQIQAxACZSULIwMDARADAWsAAQcQAQdrDQEHDBAHDGsIAQUJABEFZSQEIgMAEREAYx4pGAMTHBoCFRITFWAhARYgARcPFhdgAA8AEAIPEF4mAQwKAQkFDAlhABEnAQ4bEQ5hABsfHxtSABsbH1gAHxsfTBtLsA5QWECGABQVEhUUEm0dGSgDEhYVEhZrBgECEAMQAmUlCyMDAwEQAwFrAAEHEAEHaw0BBwwQBwxrCAEFCQARBWUkBCIDABERAGMeKRgDExwaAhUUExVgIQEWIAEXDxYXYAAPABACDxBeJgEMCgEJBQwJYQARJwEOGxEOYQAbHx8bUgAbGx9YAB8bH0wbS7ASUFhAhwAUFRIVFBJtHRkoAxIWFRIWawYBAhADEAJlJQsjAwMBEAMBawABBxABB2sNAQcMEAcMawgBBQkACQUAbSQEIgMAEREAYx4pGAMTHBoCFRQTFWAhARYgARcPFhdgAA8AEAIPEF4mAQwKAQkFDAlhABEnAQ4bEQ5hABsfHxtSABsbH1gAHxsfTBtLsCFQWECIABQVEhUUEm0dGSgDEhYVEhZrBgECEAMQAgNtJQsjAwMBEAMBawABBxABB2sNAQcMEAcMawgBBQkACQUAbSQEIgMAEREAYx4pGAMTHBoCFRQTFWAhARYgARcPFhdgAA8AEAIPEF4mAQwKAQkFDAlhABEnAQ4bEQ5hABsfHxtSABsbH1gAHxsfTBtAiQAUFRIVFBJtHRkoAxIWFRIWawYBAhADEAIDbSULIwMDARADAWsAAQcQAQdrDQEHDBAHDGsIAQUJAAkFAG0kBCIDABEJABFrHikYAxMcGgIVFBMVYCEBFiABFw8WF2AADwAQAg8QXiYBDAoBCQUMCWEAEScBDhsRDmEAGx8fG1IAGxsfWAAfGx9MWVlZWVlZQGe+vZSTgH9wb0tLKigVFQIA+vj08unn4t/a2dTRzs3KycTDve++77q4tLKpp6KhnJmTr5SvkpGQj4iGf46Ajn18b3twe0tuS2xjYVVTRkVAPjs4Ly0oSipKFScVJQ8MBwUAFAIUKgUUKyUjIiY9ASMiJj0BNDY7ATIWHQEUBiciHQEUOwEyFh0BFDsBMj0BNCMXIyImPQEjIiY1NDc2PwE+ATsBMhYVBzMyFh0BFAYrARUUBiciBg8BBhUUFjsBMhYdARQ7ATI9ATQ2OwE1NCcHIicmPQE0IwcjIiY/ATYXFh0BFAYnMzUFITI2NRE0JiMhIgYVERQWEyERIQEyNj0BNCYrASIGHQEUFjI2PQE0NjsBMhYdARQWBTQmKwEiBhQWOwEyNjciBh0BFBYyNj0BNDYyFhURIRE0NjsBMhYdARQWMjY9ATQmKwEiBhURFBYzITI2NRE0JgUUFjsBMjY0JisBIgYBnBcLDw0LDw8LPgsPD0kDAxkFBgMXAwPuFgoQQBMbBgIHRAQTCCwKEAEBCg4OCgEPNgIIAUQMDglMBQcCFgIHBQwBCwMGAwIkMAYIBS8FCAkHHw7+WgKXBwkJB/1pBgkJFgJ3/YkBuwcJHxW0FR4JDQkMCLQIDAkBAQkH6gcJCQfqBwkUFh4JDgkMEQz8uw0IAwkMCQ0JHhYDFh4JBwNkBgke/OcJBuoHCQkH6gYJag8Lsw8LFAsPDwvhCw/9AhQDBgW/AgLhAv0QChwZFQ0OBwxxBwsQCn0PCxQLDxwLD/0EAnISDwwLBwQoAgIoBQYXAgEBBAMFiQKXDQZHBwIEB0gECBgV2QkHAaAGCQkG/mAHCQGg/oACEAkHZRUeHhVhBwkJB2EIDAwIZQcJKAcJCQ4JCdceFWcHCQkHZwgMDAj9KALYCAwMCGMHCQkHYxUeHhX9GAcJCQcC6BUe0AcJCQ4JCQACAAD/agPaA1IAHwA0AFG1FwEEAwFHS7AkUFhAGAACAQJwAAQAAQIEAWAAAwMAWAAAAAwDSRtAHQACAQJwAAAAAwQAA2AABAEBBFQABAQBWAABBAFMWbcZGiQpGQUFGSslNjc2NTQnJicmIgcGBwYUFxYXFjMyNjcBFjMyNzY0JwE0NzY3NjIXFhcWFAcGBwYiJyYnJgKxMRscNTRYW9JbWDQ1NTRYWmpAdzIBIQoOEQgLC/yGLCpISq1KSCosKypISq5KSCosxTVDRUtpW1g0NTU0WFvSW1g0NSkl/t8LCwodCgInV0pIKiwsKkhKrkpIKissKkhKAAUAAAAAA3gCTQAPABMAJAAwADwAOkA3AAEDAB8BBAMIAQECA0cABAMCAwQCbQAAAAMEAANeAAIBAQJSAAICAVgAAQIBTCopERQmIgUFGCsBNCYjISIGFREUFjMhMjY1JyERIQ0BFjI3JT4BLgEHBSUmDgEWFwcOARYyPwE2NC4BBSYOARYfARYyNiYnA3gJB/0QBwkJBwLwBwkf/S4C0v1MAUQEBgQBRAYEBQ0G/sP+wwYMBgSxnAUBCQ0EnQUIDQFIBQwJAQWcBA4IAQUCPgYJCQb+SAcJCQcQAZhNoQICoQMNCwQDnp4DBAsNioUEDQsEhQQNCgEEBAEKDQSFBAoNBQAAAgAA//kDeAK4ACkAOgElS7AKUFhAFxoBAQUIAQMBEAEHAyAAAgAEBEc1AQVFG0uwC1BYQBcaAQEFCAEDARABBwMgAAIAAgRHNQEFRRtAFxoBAQUIAQMBEAEHAyAAAgAEBEc1AQVFWVlLsAlQWEApAAUBBW8AAQMBbwADAAcCAwdeAAIEAAJSAAQAAARSAAQEAFgGAQAEAEwbS7AKUFhAKgAFAQVvAAEDAW8AAwAHAgMHXgAEAAYEUgACAAAGAgBgAAQEBlgABgQGTBtLsAtQWEAlAAUBBW8AAQMBbwADAAcCAwdeBAECAAACUgQBAgIAWAYBAAIATBtAKQAFAQVvAAEDAW8AAwAHAgMHXgACBAACUgAEAAAEUgAEBABYBgEABABMWVlZQAsUJRMUIxMWIggFHCslFBY7ATI2NRE0JiIGFREjNTQmKwEiBh0BIxE0JiIGFREUFjsBMjY9ATMlASYiBwEOAR4BNwkBFjI2JgIxCQfrBwkJDQnNCQaaBgnPCQ4JCQfuBwl6AUD+igQLBP6MBQEIDQUBaQFtBA4IAgwGCgoGATUGCQkG/tujBwkJB6cBPgYJCQb+swcJCQem1gEvBAT+2wQNCgEEAR3+2QQLDQAADAAA/+sDXALBABQAKQAtAEIARgBJAEwAYQBmAGoAbgCCAP9LsAlQWEAMQDgyAwYDcQEEBgJHG0uwClBYQAxAODIDBgNxAQUGAkcbQAxAODIDBgNxAQQGAkdZWUuwCVBYQDEFAQQGBwcEZQAIBwIHCGUAAAADBgADYAAGAAcIBgdgCQECAQECVAkBAgIBWAABAgFMG0uwClBYQDcABQYEBwVlAAQHBgQHawAIBwIHCGUAAAADBgADYAAGAAcIBgdgCQECAQECVAkBAgIBWAABAgFMG0AxBQEEBgcHBGUACAcCBwhlAAAAAwYAA2AABgAHCAYHYAkBAgEBAlQJAQICAVgAAQIBTFlZQBcWFXd1X11SUVFPOjkgHxUpFikZFQoFFisBNCcmJyYiBwYHBhQXFhcWMjc2NzYFIicmJyY0NzY3NjIXFhcWFAcGBwYDBiMyAyYGDwEGHgE2PwEVFx4BFTAxETQmExQjNgcxIzcGByc+ATMXJzc+AS4BDwEOAR4BHwEiJhcyMSMwNxQHNjc0MQcvAiIOARYzFzI/ATAxPgE1NzQmA1wyMFJVxFRSMDIyMFJUxFVSMDL+lVpNSywtLSxLTbRNTCwtLSxMTR4BBAMCBgkCKQIHDAwBCxAHCAgHAQEPAQwCA1oBCQc0m2kGCAMLBt8GCAEIBuAGCVQBAQ4DAwIBDhA0BwkBCQZGBAEFAwEBCAFWYlVSMDExMFJVxFVSMDIyMFJV6S0sS020TUssLS0sS020TUssLQEtAQEnAQcGnAYMAwcGKH8BAQkGAQgGCf7lAgEKBAECFAcIBAsUAQsNBwIqAQkMCAEPCg8JAgMDBwEEFAEECA0KBQEDAwMBBAYJAAAAAwAA/+4DHwMMACMAMgBYADFALgQBAAABAgABYAUBAgMDAlQFAQICA1gAAwIDTDQzAQBHRjNYNFgsKwAjASMGBRQrASIHBgcGFRQXFhcWFxYXFhcWHwEWJxYyNzY3Njc2NTQnJicmAyYnJjU0PgEyHgEVFAcGAyIOARUUFh8BMj4BJicuATU0PgEyHgEVFAYHDgEeATc+ATU0LgEB9FFFRCcpDAsUExoWHRgcFhgiEAEFDgUjLFQ0RyknREVRVkNxSHqQe0hyQlcuTi45LwYFCAQFBiYuJUBKQCUpIwYEBgwGLDIuTgMMKSdDRVEdJiIqJislKiMlHh4qFQIFBSk6blp+R1FFQycp/QpoZaxUSHpISHpIVKxkAg0uTS40VRQBBgoMAhFFKiVAJSVAJShCEgMMDAQDFlExLk0uAAUAAAAAAyICmQAPABMAKwBHAGUAZEBhGQEGBQFHCQEICghvAAoBCm8AAQwBAwUBA18ABQAGBwUGYAAHDQEEAgcEYAACAAACUgACAgBYCwEAAgBMFRQQEAEAWFdKSS4tJyYlIx8dFCsVKxATEBMSEQkHAA8BDw4FFCslITI2NxM2JiMhIgYXEx4BAQMjAwUzMjY/ATYmJyYrASIGFBY7AQcjIgYUFgEmIgYUFxYXFgcGFxYXHgEyPgEvASY1NDc2JyY3JiIGFBc0FhcWBwYXFhcWMzI3PgEvASY1NDc2JyYBPAEGBggBWgIKB/5OBwoCUgIIAVJU7EwBn0gFCAItAQECBQhaBgkJBkUjPQcJCf7HBA0JBAkGDQgPBgIHAQgGCwQDAwQHEBIJpQUMCgUQBAUGDgUDBgUJAwQGBAMDBAYQEQkCCAUBrgcLCwf+UgUIAa7+cgGO/gYFnQMIAgcJDgl9CQwKAeIFCQ0FCQoWDRkgEA0EBQUMBgkLCg4LGyMSDQUJDQUBFgoOCRkgEA0JAgMMBgkLCg4LGyMSAAAFAAD/4gN5AtoAMgA/AEwAYQB2AHdAdD03AgQFIgECAEpEAgcGA0cOAQgACwUIC2AABQwBBAEFBGAAAQAAAgEAYAACAAMGAgNgDQEGAAcKBgdgDwEKCQkKVA8BCgoJWAAJCglMY2JOTUFANDNtbGJ2Y3ZYV01hTmFHRkBMQUw6OTM/ND8nLCkmEAUYKwEmJyY0NzYzMhcWPgEmJyYnJiMiBwYVFBceAhUUBwYjIicmDgEWFxYzMjc2NzY1NCcmJzI2PQE0JiIGHQEUFhMiBh0BFBYyNj0BNCYDIgcGBwYUFxYXFjI3Njc2NCcmJyYDIicmJyY0NzY3NjIXFhcWFAcGBwYB/iUNCwwNGh8cBQ0HBAUJEBcbJxcUFRFVJRgdNxsWBgwDBwYeGy4hHRAPHxdFBgkJDAoJGgYJCQ0JCQNnWFYzNDQzVljOWVYyNDQyVllnXlJPLjAwLk9SvVFPLjAwLk9RAY4ODQogCgwOBAQKDQMHBQgWFBseFBEgKSAkFxwHAgcMDAEIERAcGh8vHxacCQc5BgkJBjkHCf57CQc5BgkJBjkHCQJHNDJWWc5ZVjI0NDJWWc5ZVjI0/ScwLk9SvFJPLjAwLk9SvFJPLjAAABcAAAAAA8sCrQAMAA8AEwAXAC0AMgA2AFgAXQBgAGwAegCDAIYAmwCfALoAvQDAAMMAzwDgAPIAm0CYzsXEraOhmpmYhz46JyUBDwcF3t3Zq6QiHh0IBAc/AQEEgYB/bGtTTUxACQADbmVjYmEkIxwIAgAFR7KiAgZFKwECRAkBBwUEBQcEbQAEAQUEAWsAAQMFAQNrCAEDAAUDAGsAAAIFAAJrAAICbgAGBQUGVAAGBgVYAAUGBUzR0Hx70ODR4MnHubWQj3uDfIN0c1BPSUgKBRQrAScmDgEWHwEWMj4BJhc2NQcUBzY3Ig8BAyY2PwERBwYmJzURJREPAREUFwUzIjMyNzEGATYzIgU0MRcUBg8BFwcnLgEOAR8BFjMyPwE1NDYyFh0BNzY3Ni8BMDIwMScyFQMHFRQHBiMlNj0BBwM1Bw4BFxYzMjcxMjc2EyIGHQE3NTQmNxYXJTAiFQcOARcWMz8BPgEuAQ8BNzU0JTIXJgUVNwUHMDE3MhYdATcnJj4BFyUmBwUVNjMyFgU2Nwc0NTcGByU1NCYjIgYHBh0BNwUiBiMPAhQHFR4BPwE1NCYlDgEfATc+ATUvATQxIyYjJyYCC84HCwQHB80CCAkDBygBAwEBCQEBAQcCBgYVCwYMAv66CBcLAWUECgoEAQH+jgICAgKNAwYFDFHfPwMNCgMERQQJAwJ+CQwKXwcDAgNmAQYBHewGBAEBCwsf7BUGBgIFCgQBAQQG+wYJHwkMAgH9cQGIBAIDBQkFUwYFBAwGBjECjQICAv2Q+AE54QUHCf0HAwQMBf6OBQP++AEEBwkBSgIBBwMBAf65CQcEAwIGFwFdAgUBAwECAQIMBgsJAQUFBAMHDAUGAwMBAgIBBQIGNwEGDAwBNwEHCwwWAQEEAgEBCgEB/jIHDAEHAZsEAgYGBv5YUwGoAhX+Yw0DWwEBAjcCBwEIBQkBBI9NWgUDCA0FYwcBKxYHCQkHCyEDBgkFrgMB/j1RFQgFAlsDDOYL/soVBwEMBwoBAgUBZAkHFgsLBwnKAQIEAXoECwQIAR8CDAwFAgIsIwgGAgIODFJJTgEJBwtYCwUNBgFWAgJWAQEJWwEBDAIBBQEBTQwGCQECBAgjFUIDAgICAgEJBgYCBAsHCV0DDQULBAEKBQcDAQIBAQAAAAIAAAAAA48CrQAKABUAL0AsBwEDAgACAwBtBAEAAG4FAQECAgFUBQEBAQJYBgECAQJMEhETERIRExAIBRwrJSERNDY3FSIGFTMBIRE0NjcVIgYVMwOP/rHGiV2C3/3S/rHEi12C3xABT4vCAW+EW/6xAU+LwgFvhFsAAAACAAAAAAOPAq0ACgAVAC1AKgQBAAMAbwcBAwIDbwYBAgEBAlQGAQICAVgFAQECAUwSERMREhETEAgFHCsTIREUBic1MjYnIwEhERQGJzUyNicjEgFPxItchAHfAi4BT8SLXIQB3wKt/rKMxAFvgl4BTv6yjMQBb4JeAAAABAAA/7ED6AMLAAUADgAWACAALUAqCQEBAAFHGxoTEgoDBgBFIBYOBAQBRAAAAQBvAgEBAWYAAAAFAAURAwUVKzURMyURLQE2NCc3FhcUBxc2ECc3FhAHFzYQJzceARQGB8sBM/7NAWg+PjxaAlwpampCg4MikpI+UlxcUqkBaPr8pvghP7BAQVqBfVgpaQEuaz6F/oyHIpMBnpJBUtju3FAAAAACAAD/fAPoA0EABQAqACJAHyQbEgkEAQABRwIBAEUDAQFEAAABAG8AAQFmExACBRYrESEBEQEjJTQ/AScmND8BNjIfATc2Mh8BFhQPARcWFA8BBiIvAQcGIi8BJgExAVn+p+UCfQJMTAICNQIGA0xNBAQDNwICTEwCAjcCBgNNTAIGAzUCAicBGvw7ARd5BAJMTAIIAjUCAkxMAgI1AggCTEwEBgI2AgJOTgICNgIAAAMAAP9tA+gDTwAFAA4AFgAqQCcJAQEAAUcTEgoDBABFFg4EAwFEAAABAG8CAQEBZgAAAAUABREDBRUrNREzAREBJTY0JzcWFxQHFzYQJzcWEAfsAWL+ngGgSUlHaQJrL3t7TJqajgGgASH8HgEhI0rMTEpqlJFlL3cBYHtKmv5MmgAAAAIAAP9qA0QDUgAFAA8AJ0AkCgEBAAFHCwMCAEUPBAIBRAAAAQBvAgEBAWYAAAAFAAURAwUVKzURMwERASU2NTQnNxYXFAfsAWb+mgGkSkpJZwRrjQGiASP8GAEjJUpkaExKapaQZgAAAf//AAAD6AK3ABcALkArAAEAAW8AAgMCcAQBAAMDAFQEAQAAA1gAAwADTAEAFBIODQYFABcBFwUFFCsBITc2NCYiBwEGFBcBFjI2NC8BITI2NCYDuvzl2g4bJw7+1w4OASkOJhwO2gMbExsbAY3aDiYcDv7WDScO/tcOHCYN2xsmHAAAAQAAAAAD6QK3ABcAJEAhAAABAG8AAwIDcAABAgIBVAABAQJYAAIBAkwUIyQSBAUYKwkBJiIGFB8BISIGFBYzIQcGFBYyNwE2NAPa/tcNJxsN2vzmExwbFAMa2g0bJg4BKQ4BfwEqDhwmDtobJxvbDSYcDgEpDicAAwAA/7EDWgNSAAgAPwBvAJi3SkI4AwMFAUdLsCRQWEAyAAUCAwIFA20ACgAAAgoAYAAIAAIFCAJeAAMABwQDB2AABAAGBAZcAAEBCVgACQkMAUkbQDgABQIDAgUDbQAJAAEKCQFgAAoAAAIKAGAACAACBQgCXgADAAcEAwdgAAQGBgRUAAQEBlgABgQGTFlAF25sZ2VcWlVST0w+PTEuKCUkIxUrCwUWKzc0LgEGFBY+AQE0JicjNDYnNCYnDgIHBgcOAg8BBg8BBicjETMyHgQXFjsBMjU0Jz4BNCc2NTQmJz4BNxQHFhUUBxYVFAcUBisBIiYnJisBIiY1ETQ2OwE2NzY3PgI3NjMyHgEVFAczMhaPFhwWFhwWAoMsHMQ2ASI3Dg4UFw0eAhYODBYKDBYKChISBxYOHAwcAnZJQ2sCEBQKHQoJEhhHGwUVASFgTkg2aEVBDKEdKiodmRQ5IBwNDBYYFhwvSigbYjpWZA8UAhgaGAIUAVAdKgEgciA3NAEPQkoYDSYDGhQOGQsIDwcB/psCBgYIBAQpXQ8QCSooEhwnDiIJATIVMikSFCsmDAw4K05aGhcXKh0BZR4qDUkqHg5ESBgVJE5BMzhUAAADAAD/agNZAwsACABAAHIAVEBRcWgRDwQAAgFHAAACAwIAA20ACgABCQoBYAAJAAIACQJeAAMACAUDCGAABQAGBAUGYAAEBwcEVAAEBAdYAAcEB0xmY2BdKiUkJR4hGT0bCwUdKxM0LgEGFBY+AQE0JiM+ASc0JzY0Jic2NTQmKwEiDwEOAQ8CBicjETMyFh8BHgIfARYXHgIXMjYnNCYnMzI2NxQGJyMWFRQOASMiJy4DJyYnJicjIiY1ETQ2OwEyNz4BNzMyFh0BFhUUBxYVFAcWjxYcFhYcFgKDGBIIDAEdChQQAjYxR0l2EA0ODRUSCggSEgkWCxYLFhAKDR4NFxQODjYkATQBxBwsR1Q7YhsnTC4cFhMWBg4KGyE5FJkdKiodoQxBSGo6P05gIQEVBRsCWA8UAhgaGAIU/s4TNAoiDiYcEigqCRAPLy4pBQQGBAYEAgH+mwoKFAoeEg0RJg0YSkIPNjYhcCEsGzlWATc0Qk0kFRI2MC4NHCtJDSoeAWUdKhcYGAFYTQMrOAwMJioVEikAAAAGAAD/yAOhAuoAHAAxAGIAawB0AH0AaEBlHxUCAgVEAQECAkcgAQFEDQgMBgsFBAMFAwQFbQkHAgUCAwUCawoBAAADBAADYAACAQECVAACAgFYAAECAUx2dW1sZGMBAHp5dX12fXFwbHRtdGhnY2tkaywrJiQMCgAcARwOBRQrASIHBgcGFBcWFxYzMjcXFjMyNzY9ATY1NCcmJyYTBh0BJyYHBiMiLgE0PgEyFx4BFRQFFBcWMj8BFhcWPgEmIyYnJg8BJzQnJicmNzY3Njc2FhcWMjY0Jy4BBwYHBgcGFxYXJTIWFAYiJjQ2MzIWFAYiJjQ2MzIWFAYiJjQ2AnJSR0QpKSkpREdSER64AQMGBAY0KSlER4wDpQUDGBZKfElJfJQ/PUn9IwcGBgKzFxMHCQIIBxEaBwSjGgINCyAPDjY3U1a1RQQNCQVMxl9bPDsPECMLDQFWERcXIhgYoxEYGCIYGaMRFxciGBgCTykoREekR0QpKQQtAQQGBqBMXVJHRCgp/jYEB44pAgIDSXyUfEklJH1JVuoHBQIBRQUDAQkNCgIGAgM/zwYCFxtTV1VCRh8iIj4ECgwFRCUkI0xJXWBbGRqWGCIXGCEYGCIXFyIYGCIXGCEYAAAAABkAAAAAA1YC3QAUACkAPQBQAFoAZQBxAHcAiACSAKEAqAC2AL8AzgDWAN8A5gD3AQkBEQEXAR8BJwEtAAAlMjc2NzY0JyYnJiIHBgcGFBcWFxYTMhcWFxYUBwYHBiInJicmNDc2NzYHNi4BBgc2BwYHBgcGBxc0NzY3NhMWMjYmJyInJicmJyInFhcWFxYnJi8BFhcWFxYXNycuAQ4BHwE3MjcfAR4BMzI1PgEvAQcnNjcnBxcTJg4BFhcyFxYXFhc2NyYnJhcWBzc2JyYnBxYDBh4BMzI3NjcHBgcGBwYTJicGBxc2Nz4BLgEHFAcGBxc2NzYFFjMyNycGJxQnFhcWFyY3JicmMSYOARYXFh8BJjUnBhc2NycHBiMHFzcmJwYHFh8BNjQuAQcUBwYHFAc2NzY3NgUmDgEWFxYXFhcWFycmJyYnJhcwFzMyNycGNxc2PwEGBRYfARYzJyY3BgcXPwEnBjc2NzY1BwHpY1VTMDIyMFNVxlVTMDIyMFNVY1tNSy0tLS1LTrROSy0tLS1LTVMCBgwMAgEFBQQGAwQBIAcFBwZwBA4IAQUBDRIRGRUOFhgcFBUNaxQEIAQXBAoMGI4lAgoNBwElEAMFEBwCCAYCBwcBHA8HCgYcHxw7BQ0IAgUCERUUHBMHFBwtGF4NBCACDAgIHAUeAgQKAgoFJwkiBQsICgkZBAdUQgZNrwUBCA0FEBQZDBkXJP40LCApLQZHVl4DDxUYAQEUEw8GDAMGRQYJEQEfAdIGCgYHBQMQBtYGBhQHBwSiBQgNBRYcJQIgGxQRFf2oBQ0GAwYCDRIXICMQGxcRDgyBEAk8QgZObQZNPwNJ/uADBQgWDhAYuAcIBhAPBgaYERACIAQyMFNVxlVSMDIyMFJVxlVTMDICui0tS022TUwsLi4sTE22TUstLWYGDAQGBgYVERIZGiAfBScpHRwY/eAECw0EDhEYIScCLicdFg7lM0QFTDsMFgICz88GBwIKB88DAd+cBgcBAQoHnQQfAgKcBp0BrAQCCg0EERYcJy0EDEI0HOwyRxA5Nx4XEA7+nwYMBAphYQ8pKx8dGAFwDhAsDh8RaAQNCgIEAQwODh4PEBmLBAYfCwoVCAEEBQQQEAQEBAIGDQsQAQEDCxUFEBABAh8CAQMfUQ8PDAQQDncEDQoBBAIOFBIOFg8QDAwQWwMDCw0DAgYIBggDIgQGBQYFHiAOHxAXHxMbIx8jBwoRAiACDgECHwMEHwIRCAcWDhAAAAAACwAA/7MDpgLbABIAUwBjAHMAjgCcAKkAtQDDAM8A3ACuQKsHAQEPOwENEG1lAgkIA0ebAQ0BRoyLiomDeAYKRAAOAAwADgxtAAwCAAwCawABDxAPARBtAA0QAxANA20AAwYQAwZrCxMCCgcKcAAFAAQABQRgAAAAAg8AAmARFAIPEgEQDQ8QYAAGAAgJBghgAAkHBwlUAAkJB1gABwkHTMXEdXTa2NTSy8nEz8XPvLqvrqCfhoV0jnWOcW9pZ2JfWldRUDIxIyEVFSIVBRcrATQmIyIOARUUFjI2NTQ+ATMyNgcUFzAxFhcWFxYPAQYeATMyNjc2JyYnNDEjJjU0PgEyHgEVFAcGBwYXFhceAT4BJxQmNzY3Njc2NzY1NC4BIg4BATU0JisBIgYdARQWOwEyNiU1NDY7ATIWHQEUBisBIiYXIgYdARQWHwEWMj8BNj0BNCYiBh0BByc1NCYlNiYvASYOARYfARYzMgEWMzI2Ji8BJg4BFhcTBw4BFjI/AT4BLgEBDgEXFjMyPwE+AS4BBxMjIgYUFjsBMjY0JgU0JisBIgYUFjsBMjYB8wkHLEwsCQ4JIz0kBwn1MhgNCwQDAQIDBAoDCQkBAQsOJAErOF9yXzgrJA4LAgEEAwwLBQMDAQEEBgoNEzJBboJuQAF7FxDSEBcXENIQF/8ABAPSAwQEA9IDBCAHCQYEVAIJAlQJCQwKRUQJAbkEAgVqBQ0IAgVqBQUI/ZcFBAkIAgVtBQ0IAwVxcQUCCA4DcgUCCA0B6AUCBAQIBgRlBQIIDQVUeAYJCQZ4BgkJ/SsJBnwGCQkGfAYJAmYHCSxMLAcJCQckPSMJjVJBIR0XFQ4LCQYNBBEPGSArMgE5RjlfODhfOUg3MisgGg8IBQUFDAYCEAkNDxMVGBtAUkFuQEBu/k0NEBcXEA0QFhYQDQMFBQMNAwQEOwkHKQUIAScBASgFCSgHCQkHHiAfHwcJlgUMBE8EAwoNBE4DAb0DCw0EUAQCCg0E/mNUBAwMA1QEDQoCAWcEDAUHA0sEDQoCBP7+CQ0JCQ0JDwYJCQ0JCQAAAAADAAD/agMSA1IACAAhADEAY0uwJFBYQBwGAQAAAQQAAWAABAADBANcAAUFAlgHAQICDAVJG0AiBwECAAUAAgVgBgEAAAEEAAFgAAQDAwRUAAQEA1gAAwQDTFlAFwoJAQAuLSYlFhUJIQohBQQACAEICAUUKwEiBhQWMjY0JiciBwYHBhURFBcWFxYyNzY3NjURNCcmJyYTFA4BIi4BNRE0PgEyHgEVAfQUHB0nHBwUTkJBJicnJkFCnEJBJicnJkFCmj5rfms+Pmt+az4CsRwmHR0mHKErKkhKVv6SVkpIKisrKkhKVgFuVkpIKiv9VUd5R0d5RwFuR3lHR3lHAAAAAf/9/44BrwNSABYAPbUMAQECAUdLsCRQWEATAwEBAgACAQBtAAAAbgACAgwCSRtADwACAQJvAwEBAAFvAAAAZlm2JCMkFAQFGCslFg8BBiIvASY2OwERNDY7ATIWFREzMgGrBAfDBg8FxggKC30KCGsICn0LfQoJ1wUF1wkVArgICgoI/UgAAAEAAAAAA+gCNwAVAB5AGwEBAAEBRwABAAABUgABAQBYAAABAEwdIwIFFisBFRQGIyEVFAYvASY0PwE2Fh0BITIWA+gKCP1IFgjXBQXXCRUCuAgKAZRsBwp9DAoIxAUPBsUICQx9CgAAAQAAAAADxAI4ABYAHkAbDAEAAQFHAAEAAAFUAAEBAFYAAAEASiYXAgUWKwEUDwEGJj0BISImPQE0NjMhNTQ2HwEWA8QF1wgW/UgICgoIArgWCNcFAWAIBsUICQx9CgdsBwp9DAoIwwYAAAAAAf/+/2oBrwMuABYAH0AcBAEBAAFHAAMAA28CAQABAG8AAQFmFCQjIQQFGCsBBisBERQGKwEiJjURIyImPwE2Mh8BFgGrBQt9CghrCAp9DAgHwwUPBsYHAj8L/UgICgoIArgWCNcFBdcIAAAAAgAA/2oDdgNSABUAJwBMQAwNCgIAAgFHDAsCAERLsCRQWEASAAIAAAIAXAADAwFYAAEBDANJG0AYAAEAAwIBA2AAAgAAAlQAAgIAWAAAAgBMWbYYFxsnBAUYKwEOAhYXHgEzMjcTNwM2NzYmJy4BIgUeAQ4BBwYiJicuAT4BNzYyFgEqQFgmEiUyq2I6P6V2pVYdExIlMazDASoXDBg4KDZ7bB8XDBg4KDZ7bAMhJXOOkEBVYxX+4kQBHkpuRpBAVWP8KFpaSRcfPzUoW1lJFx8+AAAM//P/YAPzA1wAEAAZACMALQA4AEEASgBTAFwAaABzAH8AHUAaf3lzbmhiWlZRTUlFPzs3MiwnIh0YFA0FDC0rEyY3PgIXHgIHDgEEJy4BEwYSBCQSAiQEBzY3NhYHBgcGJhc2NzYWBwYHBiYXNj8BNhYHBgcGJhc+AR4BDgEuATcGHgE+AS4BBhc+AR4BDgEuARceAT4BLgEOARcmNzY3NhYHBgcjBhcmNzY3NhYHBgcGFyY3Njc2FgcGBxUGBRIvM9b+g3+mIi8z1P8AhH+kSESQAU4BUIKM/q7+tgs5jw8MDoM0Bh5BL3cODA5qLQYaPiddAg4MDlQhBh5BHZCOQD6MkjxXEypeYiImYl4mCjIsGhguMBYpBRYaBgYaFgpvBg5UIQYeByddAg4SBg9sKwYcBTF3DhIGDoM0Bh4GOY8PARR/hX6mIC0z1v6EfqgeLTPUAWyo/rKEjgFQAUyGjr+QPQgeBjiFDgwKeTMGHgUtbQ4MCF4pAQYcByNUEAwISTw6kI5APowxMGAkKGBgJChHGBYUMiwaGC4LCwoKFhoGBhrdDwYjVBAMEF8pBisNCC1sDwwPdzMGLA8GOIUODA6QPQIGAAAG////aQKwA1MADwAZAB0AJwAwADkAikuwJFBYQDIACAAJBggJYAAGAAUEBgVeAAQAAwoEA14ACgALAgoLYAACAAECAVwABwcAWAAAAAwHSRtAOAAAAAcIAAdgAAgACQYICWAABgAFBAYFXgAEAAMKBANeAAoACwIKC2AAAgEBAlQAAgIBWAABAgFMWUASOTY1MjAtNCQRERETNDUzDAUdKxURNDYXITIWFxEUBichIiY3FBYzITI2PQEhNSERITUhNTQmByEiBh8BNDsBMhQHIyITNDsBMhQnIyI2KAH0JzYBOCb+DCc4QBAPAfQNEv3OAjL9zgIyEg3+DA4SAdoQXg8PXhAgDx8QEB8POAMsJzgBNij81Cc4ATYoDhISDj4gAnAgPg4SARAPDw8eAf0CECABAAEAAP9qA+gDUgALAAazBwEBLSsBJwkBBwkBFwkBNwED6GT+cP5wZAGQ/nBkAZABkGT+cALuZP5wAZBk/nD+cGQBkP5wZAGQAAkAAP/nA+gC1QALABQAHwAqADcAVgCdAKoAtwCEQIEuAQUATkM0BgQBBSQZAgQCSkcCCAQERw4DAgAFAG8GDwIFAQVvDQELAQIBCwJtAAEAAgQBAmAABAAICgQIYBEMEAMKBwcKVBEMEAMKCgdYCQEHCgdMrKufnlhXLCuysau3rLelpJ6qn6qSkIKBc3FmZFedWJ1JSCs3LDcTGxISBRcrAS4BIg4BFzY3Njc2AzQmIgYUFjI2FzY3NicWFxYGBwYlNjc2JxYXFgYHBhMiBgcWFxYXFhc2LgEXFjc2NzY3NhYXFhcmDgEHJiIHLgIHNjc+ARcWFxYlIgcGBwYHBicmJyYnJiMiBwYPAQYHBhUUHgEzMjc2NzY3Njc2BzY3Njc2MhcWFxYXJhcWFxYXFhcWMzI+ATU0JyYvASYnJhMiLgE0PgEyHgEUDgEhIi4BND4BMh4BFA4BAr8JKjYqEggLJR8VHoYZIhkZIhndMBkaCRUBAR8ZG/2bMBkaChUCAR8ZG6UbKgkbHhUfJQsIEioUTk4dKCUNFh4OJiA6bUoHJ1soB0ptOh4oDh4WDSUoAUgaIBYkJw40NA4nJBYgGiIbHxdXKBEUOF85HhoYFBISDBEdAhAMEBESKhIREAwQAh0RDBISFBgaHjlfOBQRKFcXHxslIjkiIjlEOSIiOf2WIjkiIjlEOSIiOQKeGB8fMhsEEA0HCv6ZERkZIhgYugojJTUXHRsvCQsLCiMlNRcdGy8JCwJ3HxgDCgcNEAQbMh/lGBgJEhADBg0ZQDoMKVo7FBQ7WikMMkgZDQYDEBJ7CgcPEAUREQUQDwcKEBMqmkktNio5XzgHBw0LEA0TIgIRCg0HBwcHDQoRAiITDRALDQcHOF85KjYtSZoqExD9xiI5RDkiIjlEOSIiOUQ5IiI5RDkiAAAAAAIAAP9oA9EDUAAZAC8ARrYlDQICAwFHS7AfUFhAFwAAAwBvAAIDAQMCAW0AAQFuAAMDDANJG0ATAAADAG8AAwIDbwACAQJvAAEBZlm2HBocJQQFGCsBNDcBPgEzMh8BFhQHCQEWFA8BBiMiJicBJiUUFwEWMj8BNjQnCQE2NC8BJiIHAQYBigoB0gQOBg0KMgoK/nYBigoKMgoNBg4E/i4K/n8KAdMKGgoyCgr+dgGKCgoyChoK/i0KAVwNCgHTBAYKMgoaCv52/nYKGgoyCgYEAdMKDQ0K/i0KCjIKGgoBigGKChoKMgoK/i0KAAAAAAIAAP9xAmEDUAAYADEAe0AKJgEDBTABBAICR0uwH1BYQCMGAQMFAgUDAm0AAgQFAgRrBwEEAAEEAVwABQUAWAAAAAwFSRtAKgYBAwUCBQMCbQACBAUCBGsAAAAFAwAFYAcBBAEBBFQHAQQEAVgAAQQBTFlAFBoZAAAkIxkxGjEAGAAXISkhCAUXKwETIyIOAhURFB4COwEDIyInJjU3NDYzAyIuAjURND4CFzMVBgcOARcVFBcWFxUCYAE/LlNAIyNAUy4/AR4jGxkBMyQjIz0wGhowPiIFLB4VFgEqISkCLAEkI0BTLv3pLlNAIwEiGRsj6iQ0/X0ZMD8iAhkiPjIZAbIKHhU1Hek9KiEHswAACQAA/78DTgL9AAMABwAVAB4AJgAqAC4AOgBGAPtAIjUBEQswARARMgEPEEEBAw48AQIDPgEAAgZHOQEORQEBAkZLsCRQWEBSABELEAsREG0AAgMAAAJlAAYACQUGCWASBwIFDAEKCAUKXgAIAAsRCAteABAADw4QD14ADgADAg4DXgAAAAENAAFfAA0EBA1SAA0NBFYABA0EShtAUwARCxALERBtAAIDAAMCAG0ABgAJBQYJYBIHAgUMAQoIBQpeAAgACxEIC14AEAAPDhAPXgAOAAMCDgNeAAAAAQ0AAV8ADQQEDVIADQ0EVgAEDQRKWUAkCAguLSwrKikoJyYlJCMiISAfHRwZGAgVCBQTIRIREREQEwUbKyUzFSM1MzUjAREhETMyNzY3IRYXFjMFFBYyNjQmIgYFIwcjJyMRIQMzNSM1MzUjBzcWFz4BNxcOAQcmBzcWFz4BNxcOAQcmAheKioqKATf9TGgcHRAfARQeER0c/usVHBUVHBUBOItFhkmLAiryioqKiuENFBcZKB4EGSkaIhoOEhkYKB8EGSoaJLEiRSIBwv0HAvkXDCIiDBcjDhQUHBUVMEZG/ZEBNyMjIiUMCRAcIhMKFjcwKJIMCRAcIhMKFjguKQADAAAAAAOXApkAAwAGAAsAPkA7CgkIBQQDAgFHBAEBBQECAwECXgYBAwAAA1IGAQMDAFYAAAMASgcHBAQAAAcLBwsEBgQGAAMAAxEHBRUrExEhEQcJAQMRCQERUQNGVv6z/rQRAV0BXQKZ/YsCdUb+8gEO/hYBnf7lARv+YwAAAAUAAP9qA+gDUgALABgAJAAsADAA2UAVFhUQDwsHBgcDACABAgMfGgIEAgNHS7AKUFhALAAEAgUFBGUAAwACBAMCYAsHAgUACQgFCV8ACAAGCAZaCgEAAAFYAAEBDABJG0uwJFBYQC0ABAIFAgQFbQADAAIEAwJgCwcCBQAJCAUJXwAIAAYIBloKAQAAAVgAAQEMAEkbQDMABAIFAgQFbQABCgEAAwEAYAADAAIEAwJgCwcCBQAJCAUJXwAIBgYIUgAICAZWAAYIBkpZWUAfJSUNDDAvLi0lLCUsKyopKCcmIyIdHBMSDBgNGAwFFCsBJicmBwYHFz4BFhcnMhYXNy4BIgYHFz4BAxc+ATIWFzcuASIGFzUjFSERIREDIREhAs47UU5OUTssL39/L65OjzcsQaS2pEEsN48mLA4mKCYOLBc8Qjx8Pv4rA+g+/JQDbAJoOxUUFBU7LC8hIS/YOzcsQEREQCw3O/7uLA4QEA4sFxkZ635+/jwBxP56AUgAAAYAAP9qA+gDUgALABMAFwAbAB8AIwClS7AkUFhAOwACAAsAAgttAAkADAEJDF4AAQADBAEDYAAEAAACBABgAAsACgcLCl4ABwAFBwVaAAgIBlYNAQYGDAhJG0BBAAIACwACC20NAQYACAkGCF4ACQAMAQkMXgABAAMEAQNgAAQAAAIEAGAACwAKBwsKXgAHBQUHUgAHBwVWAAUHBUpZQBsUFCMiISAfHh0cGxoZGBQXFBcSIyERJSAOBRorATMyPgE0LgErAREzETMyFhQGKwEBESERAyERIQchESEnIREhAZR7Iz0jIz0juT57HSkpHXv+bAPoPvyUA2xS/TgCyD79tAJMASsjPEg8I/5PAXQpOSoB6vwYA+j8VgNsUv04PgJMAAAFAAD/kQPoAysAdADwAPQBAAERAAAFIicmJyYnJiIHBgcGBwYiJyYnJicmIgcGBwYHBiInJicmJyYiBwYHBgcGIicmJyYnJiMVMhcWFxYXFjI3Njc2NzYyFxYXFhcWMjc2NzY3NjIXFhcWFxYyNzY3Njc2MhcWFxYXFjI3Njc2NzYzNSIHBgcGBwY3BgcGIicmJyYnJiIHBgcGBxE0PgEyHgEdATM1NC4BIyIGBy4BIyIOARURJyYnJiIHBgcGBwYiJyYnJicmIxUyFxYXFhcWMjc2NzY3NjIXFhcWFxYyNzY3Njc2MhcWFxYXFjI3Njc2NzYyFxYXFhcWMjc2NzY3NjM1IgcGJSM1MwMyFhcGHQEjNTQ+ARMiBwYHBgc1MxUmJxYnJicmA2sPCgYOEwwWNhYMEw4FCx4KBg4TDBY2FgwTDgULHgoGDhMMFjYWDBMOBQseCgYOEwwWGw8LBQ4UCxY2FgsUDgYKHgsFDhQLFjYWCxQOBgoeCwUOFAsWNhYLFA4GCh4LBQ4UCxY2FgsUDgYKDxsWDBMOBQseDAcLHgoIDBUKFjYWChUCAiI6RDoiPTJWMydHGhpHJjNWMwMVChY2FgoVDAcLHgoIDBUKFhsPCwcMFQoWNhYKFQwICh4LBwwVChY2FgoVDAgKHgsHDBUKFjYWChUMCAoeCwcMFQoWNhYKFQwICg8bFgr+sNLSVB01EhDSIjoNGxYKFREI0gYHAQ0VChYxBQIJDQUICAUNCQIFBQIJDQUICAUNCQIFBQIJDQUICAUNCQIFBQIJDQUIPQUCCQ0FCQkFDQkCBQUCCQ0FCQkFDQkCBQUCCQ0FCQkFDQkCBQUCCQ0FCQkFDQkCBT0IBQ0JAgWnCQMEBAMJDQQJCQQNAgEB/CI6IiI6Irm5M1YzHxwcHzNWM/4EAw0ECQkEDQkDBAQDCQ0ECT4EAwkNBAkJBA0JAwQEAwkNBAkJBA0JAwQEAwkNBAkJBA0JAwQEAwkNBAkJBA0JAwQ+CQSlbwFWGxchK5ubIjoi/aMJBA0LA4KCAgQBCQ0ECQAAAAsAAP9qA+gDUgAHAA8AFgAdACUALQA1AD0AUgBfAGwAiECFPCQiBQIFAgA6AQYFHRsWFAQHBjABBAczMiwNCgUBAwVHKgEDAUYEAQBFDAEBRAgBAAIAbwkBAQMBcAoBAgAFBgIFYAwBBgAHBAYHYAsBBAMDBFQLAQQEA1gAAwQDTGFgVFM/PgkIAQBnZmBsYWxaWVNfVF9JSD5SP1IIDwkPAAcBBw0FFCsBMhczJwczNhMiJyMXNyMGATUmNDc1ByUVFhQHFTclNjc2PwEnFwEGBwYPARcnBSYvAQc3JyYBFhcWHwE3DwEiBwYHBhQXFhcWMjc2NzY0JyYnJgMiLgE0PgEyHgEUDgEDIg4BFB4BMj4BNC4BAfQbHgQ9PQQgGRkgBD09BB7+awQEegNuBQV6/NkTEhYWA4IrAmoYDRIaA4Ir/bsWDwMrgQIWAdseDhITAyuC4FNIRSkqKilFSKdHRigqKihGR1REc0REc4hzREN0Qx40Hh4zPDQeHjMC3QV6egX9AgV6egUBQgQmKCQEPT0EHjQgBD3jGhIWDwMrgv4+Hg4SEwMsgi4WFgKCLAMPAlgYDRIaA4EqBCopRUimSEUpKiopRUimSEUpKv3SRHOIc0RDdIh0QwFqHjM8Mx4eMzwzHgAABwAA/2oDnANSAA0AGwAuADEANAA/AEgAMkAvR0Y8OzQzMTAsKCQbDQ0BAAFHQ0I2FhUGBQcARQAAAQBvAgEBAWYrKSYlHx4DBRQrAT4BNCYnBxYXFhQHBgchJicmNDc2NycOARQWFyU0JiIGFRQWFwMzNTcXFTMDPgEDNx8BJzcBBxYVFAYHFzY0JwU0NycGFBc3JgK/GRoaGUMOCQsLCQ7+8A4ICwsIDkMZGhoZASAyRjIYE/9Z0NBZ/xMY5SYq0NhIAUtASCYmP2Jd/WJMQ15eP0gB2RxJTkgdNw4VGDQYFQ4PFBg0GBQPNx1ITkkcjCMyMiMXKAn9TQS2tgQCswko/cpqIki+yAG0N1pcL1wwN3X6cO1cXjNw+nE4WgAAAQAA/94DnQLoAB0A9EuwCVBYQD4ACQQFBAkFbQ8BDgcBBAkOBF4ABQAGCAUGXgAIAAsDCAteAAMKAQIBAwJeDAEBAAABUgwBAQEAVg0BAAEAShtLsApQWEBFAAkEBQQJBW0ACgIBAgoBbQ8BDgcBBAkOBF4ABQAGCAUGXgAIAAsDCAteAAMAAgoDAl4MAQEAAAFSDAEBAQBWDQEAAQBKG0A+AAkEBQQJBW0PAQ4HAQQJDgReAAUABggFBl4ACAALAwgLXgADCgECAQMCXgwBAQAAAVIMAQEBAFYNAQABAEpZWUAcAAAAHQAdHBsaGRgXFhUUExERERERERERERAFHSsBESM1MzUhNSERIxUzFSM1IREzNTMRIzUjESEVIREDnYpA/u4BErxZpv5IzUpKzQIE/bUC6Pz2S45JAZ2eSef+7IL+qYr+60sDCgADAAD/wgO1AvoAAwAOABcATEBJFxYVAwAFAQABRwUBAEUAAAEAbwkFAgEHAW8ABwADBgcDXggBBgICBlIIAQYGAlYEAQIGAkoEBBQTEhEQDwQOBA4REREUEQoFGSsBNSMVCQIzESE1MxUhEQMjNSEVIxEJAQMgcQEG/j/+P3ABBpYBBktw/tRwAQYBBgIWv0/+swHB/j/+ibu7AXf+1Lu7AYABA/76AAAEAAD/5wPoAtUADwAfACkAOgCmQB82LwIBADcuAgMBCQgBAwIDGxQCBAIERyYlJBwTBQRES7AOUFhALQAABQEFAGUAAQMDAWMIAQQCBHAABgkBBQAGBWAAAwICA1QAAwMCWQcBAgMCTRtALwAABQEFAAFtAAEDBQEDawgBBAIEcAAGCQEFAAYFYAADAgIDVAADAwJZBwECAwJNWUAbKyohIBEQMzIqOis6ICkhKRgXEB8RHxcUCgUWKxMnNjc2MhcWFwcmJyYiBwYXMhYXNyYnJiIHBgcXNjc2FyIHBgcXNyYnJgMyFxYXNyYnJiAHBgcXNjc2vD9HX2TaZF9HPzpQU7ZTUP43YiI/Lz9ClEI/Lz8jMDE3JCIfGH19GB8iJIB0b1I/XYCE/tqEgF0/Um90AR0+WTI0NDJZPkoqKysqZzMsPjwhIiIhPD4tGBpdEhAefHweEBIB1Dw6aT53Q0VFQ3c+aTo8AAAEAAD/sAPoAwwAKwAyAD4ASgC3QAoRAQcDHQEKCwJHS7AZUFhAPQAEAgMDBGUAAQACBAECXgADDQEHAAMHYQgFAgAADAsADGAPAQsACgkLCmAOAQkGBglUDgEJCQZYAAYJBkwbQD4ABAIDAgQDbQABAAIEAQJeAAMNAQcAAwdhCAUCAAAMCwAMYA8BCwAKCQsKYA4BCQYGCVQOAQkJBlgABgkGTFlAIkE/NTMtLEdEP0pBSjs4Mz41Pi8uLDItMjwlERERESYQBRsrJT4BNTQuASsBAyEVIRchNSMVDgIHIyIOARUUFhcOARUUHgEzITI+ATU0JgEhFyE+AgEhIiY0NjMhMhYUBichIiY0NjMhMhYUBgO6FRkjPCMnUv5ZAXUZ/s4+N1w7BwwjPSMZFRUZIz0jAuMjPCMZ/bQBXSD9zQc0TgIQ/R0dKCkcAuMcKCgc/R0cKSkcAuMcKCiWEjUdIzwjAZA+ejI0BztdNyM8Ix01EhI1HSM8IyM8Ix01AZKaK0co/dgoOSgpOCjHKTgoKDgpAAH/8wAAA28CVAANAAazCAMBLSsTCQE2FxYHAQYnASY3Nj8BcgF0FhoaGv50Fhr+dBoaGAI6/pwBZBoaFhr+eBYWAYgaFhgAAAH/9P+iAd4DHAANAAazCQMBLSsFFgcGJwEmNwE2FxYHAQHEGhoaFv54GBgBiBYaGhr+mhQaFhoaAYoYGgGKGhoWGv6MAAAAAAH/8/+iAd0DHAANAAazCwUBLSsXCQEmNzYXARYHAQYnJg0BZv6aGhoaFgGIGBj+eBYaGhQBcgF0GhYaGv52Ghj+dhoaFgAAAAH/9AAAA2wCVAAMAAazBwMBLSslCQEGJjcBNhcBFgcGAyT+jP6OGjAYAYwaFgGMGBgaggFm/poWLhoBhhoa/noaGBYABQAA/2oDvwNSAAwAGQAdACEAJQCeS7AkUFhALwAGAAgABgheCgEAAAMCAANgCwECAAEJAgFgDgEJAAQJBFoNAQcHBVYMAQUFDAdJG0A2DAEFDQEHBgUHXgAGAAgABgheCgEAAAMCAANgCwECAAEJAgFgDgEJBAQJUg4BCQkEVgAECQRKWUArIiIeHhoaDg0BACIlIiUkIx4hHiEgHxodGh0cGxQTDRkOGQcGAAwBDA8FFCsBIg4BFB4BMj4BNC4BAyIuATQ+ATIeARQOAQERIREHFSE1GQEhEQH0P2s+Pmt+az4+az8uTi4uTlxOLi5O/gcDlj785gMaAco+a35rPj5rfms+/m4uTlxOLi5OXE4uAxr8GAPoPrm5/JQCdf2LAAAAAAQAAP+UA+gDKAASAB8ALgA2AGJAXwoBBQYoCwIBBQEBBAcDRwAFBgEGBQFtAAIABgUCBmALAwIBCQEHBAEHXgAEAAgKBAheAAoAAApSAAoKAFYAAAoAShMTNjU0MzIxMC8uLCclISATHxMfGhgXFhUUDAUUKwEXBwYnLgEnJj8BFwcGFxYXFjclESERMxEhMhceAR0BBSERNCcmJyYHNiYnJiMhASMVITUjESECOzYnJTEtSQYHJCc3Jw4MDBcYDwHU/BinAa4ePDVd/bkB9BoWIh8WCgENDxr+wAKbVP1mVANCAZBnFBIpJYk6QBQVZhUJJiMdIAgN/gwB9AGgNjF8GKXRAV4aDwwCAgYSRRkd/l/Q0P6zAAAFAAD/TwPFA1IAFQAvADYAQwBTACBAHVNMS0M+PTYxLwoCAQwARSMiCwMARAAAAGYYAQUVKxM3EwcGFxYXFhc3EwcGJyYnJicmNzYXBwYHBhcWFxYXFj8BJwcGJyYnJicmNzY/AR8BNiYnJic3HgIXFgcnNi4CJzcWFx4BFxYHJzYnLgEnJieWdqlyChkYJSYXcKt3XnBmXVoyMwwOrCs/AgEvLUlLTlVBKV8qJi8sKSgXGAQEJiroegcFDBkyJzFRNAUFD0sLCCQ5Iz5MPT9OCAcWTRIGBj8yMT0DGzf+tzgZQj42OQE3/rY7KkE8g3+SmHN/BRUhZl1+eWxwNjweFLcVEx4bOzlARDM4FRWIJBgyFi4Qgw9CXTUzMhYjSUIuC88WMTOPUU5MFz0+QXMpJxIAAAUAAP9qA+gDUgAnAEcAUABlAHkBKEAuFgEKAg8BCwp5d3VubUIVEAgDC3YBAQNlYWBZWAUGAQVHOgEKAUZ4AQJFYwEAREuwJFBYQD0ACgILAgoLbQALAwILA2sJDQIGAQcBBgdtAAcIBAdjAAgEAQgEawUBAwABBgMBYAAEDAEABABdAAICDAJJG0uwJVBYQEAAAgoCbwAKCwpvAAsDC28JDQIGAQcBBgdtAAcIBAdjAAgEAQgEawUBAwABBgMBYAAEAAAEVAAEBABZDAEABABNG0BBAAIKAm8ACgsKbwALAwtvCQ0CBgEHAQYHbQAHCAEHCGsACAQBCARrBQEDAAEGAwFgAAQAAARUAAQEAFkMAQAEAE1ZWUAjSUgBAHFwaWhcW1RTTUxIUElQR0YuLSkoGRcIBQAnAScOBRQrBSImJwEmKwEGJicuATU0Nxc+ATc2Nyc2MzIWFx4BBwYXAR4BFRQOAQEyFhcBFjI2NCcBLgE3NiYnJicXFgcGBwYvARYXHgE3ASIGFBYyNjQmJQcGIiY0PwEnBwYiJjQ/AScPAT8BEzc2MhYUDwEXNzYyFhQPARcBJwEDXxsyFP44EBsFNWUlIiUenw4fDREDoEJGMFshJiUEAxUByBMVJT/9hxw2FAHIEC0fEP44FhYCAhcZHys+BwUIG0ZcPgsfGEIkAl8JDAwSCwz+IMYFDwoFxifGBQ8KBcYq2CzZ2LPOBQ8KBc4nzgUPCgXOKgEBrf7/lhUTAcgSBCUmIlkwR0KfAhUQFRGfHiUiJWQ2GxX+OBMzGyU/JQJWFxT+OBAgLBAByBY7ICRBGR8LPiMbISJXFT4rHhkYAv5JDBILDBANjMgFCg8FyCfHBQoPBccq2tMm2gG8zwUKDwXPJ88FCg8F0CoBA63+/QAAAgAA/70D6AL/ABEAHQA0QDEcEg4FAQUAAQFHCQECRQACAAEAAgFeAAADAwBSAAAAA1YAAwADShsaGRgWFRQTBAUUKxM3FhcWFzY3NjcXBgcGByYnJgURIREhNjchESERBuRCPSsvPntjZZUVfWZnglg7SAGt/WUCdylH/MYDQTABrj0eGRwtjFVWXTJtiIvpaD9MNP7uApohM/y+AeBCAAMAAP+cA9YDFQAnADAASgBAQD1JR0VDQkFAPz49Ozk3NTQzMhQSAUQDAQACAG8AAgEBAlQAAgIBWAQBAQIBTCkoAQAtLCgwKTAAJwEnBQUUKwEiBgcGFRQXFhcWHwEWFxYXFhcWFzY3Njc2NzY/ATY3Njc2NTQnLgEDIiY0NjIWFAYBJQcnBRM3FhcPAT8BBxc3FzcnHwEvATY3FwH0OGMdHwcHDQsSIxcOFA8SDA4ICA4MEg8UDhcjEgsNBwcfHWM4IS4uQi8vAcH+89Xg/v6hnxsPjUVrPBmoFBOmGD9tRZARGaIDFTcvMDceGhgXExcqGxMbHCAjKC4uKCMgHBsTGyoXExcYGh43MC83/u0vQi4uQi/9mmFhYWEBaUAmIDicKGx6SFFRTHp0KKA4IiRAAAAADQAAAAADiAKvAAMABwALAA8AEwAfACwARwBRAFUAWQBqAG4B6kAWPgEPClE8Ag4PTC8oJQQMDTEBCwwER0uwE1BYQHQAISUKJSEKbQAAAgECAGUAASQkAWMpASMAJSEjJV4bGhgTEhEGChcnAg8OCg9gAA4ADQwODV4oFQIMHBkWFBAFCx0MC14AHQAeAx0eXx8EJgMDIAEFBwMFXggBBwkGAgIABwJeACQiIiRSACQkIlkAIiQiTRtLsCVQWEB1ACElCiUhCm0AAAIBAgBlAAEkAgEkaykBIwAlISMlXhsaGBMSEQYKFycCDw4KD2AADgANDA4NXigVAgwcGRYUEAULHQwLXgAdAB4DHR5fHwQmAwMgAQUHAwVeCAEHCQYCAgAHAl4AJCIiJFIAJCQiWQAiJCJNG0B2ACElCiUhCm0AAAIBAgABbQABJAIBJGspASMAJSEjJV4bGhgTEhEGChcnAg8OCg9gAA4ADQwODV4oFQIMHBkWFBAFCx0MC14AHQAeAx0eXx8EJgMDIAEFBwMFXggBBwkGAgIABwJeACQiIiRSACQkIlkAIiQiTVlZQFxaWi4tFBQEBG5tbGtaalpqZ2RhYFlYV1ZVVFNSUE9OTUtKSUhBQDs6NDItRy5HLCsqKScmJCMiIRQfFB8eHRwbGhkYFxYVExIREA8ODQwLCgkIBAcEBxIRECoFFyslIRUhNxUzNSsBFTMHMzUjISMVMyc1IxUzNSM1MzUjNR8BMzcjBycjBycjFzM3IicjBxYzMjY1NCcmNDIfATcjJiIGFRQXFhQHMzUjFScjFTM1BSEVIRUjFTMBERQGJjURIxEUFjMhMjY1EQMhESEBTAG1/kuGqcplZWVlZQG1ZWXqKSsbGBhICBEREAkIEAkIEQ8RSQoFAQMICg4NEQsPBgEEAQcVDRIKvRAOFhIPAUX+SwG1ZWX9xBERQygcAqAcKEP9wwI9+SKpZWUiQyEh/w1BDQ4NDAkrQSwsLS1BDAQNBAwIDgYECgMBDgMLCQ0GBAsMQSgoQSxPIiEiAVH9vQwKCgwB//3mHCgoHAJe/eUB1wAABgAA/8wDhgLwAAMABwALAA8AEwAZARRLsA1QWEBIDQEBCgMKAWUAAwkJA2MACwQCBAsCbQACAAQCYwAAAG4ADAAKAQwKXgAJAAgHCQhfAAcABgUHBl4ABQQEBVIABQUEVgAEBQRKG0uwE1BYQEoNAQEKAwoBZQADCQoDCWsACwQCBAsCbQACAAQCAGsAAABuAAwACgEMCl4ACQAIBwkIXwAHAAYFBwZeAAUEBAVSAAUFBFYABAUEShtASw0BAQoDCgEDbQADCQoDCWsACwQCBAsCbQACAAQCAGsAAABuAAwACgEMCl4ACQAIBwkIXwAHAAYFBwZeAAUEBAVSAAUFBFYABAUESllZQCAAABkYFxYVFBMSERAPDg0MCwoJCAcGBQQAAwADEQ4FFSsTESERAyERIQMhNSE1ITUhNSE1IRMhESMRIegCnkP96AIYZP6xAU/+sQFP/rEBT0P9g0MCwAJq/WICnv2lAbT+sCJDIkMhAU/9gwLAAAUAAP+UA+gDKAADAAcAFAAdACUBRkAUIAEBCCEBBAIiAQcGA0ckIx8DCEVLsApQWEA7CwEIAQEIYwAEAgMCBGUAAwYCAwZrCgEGBwIGYwAHBQUHYwkBAQACBAECXwAFAAAFVAAFBQBXAAAFAEsbS7APUFhAPAsBCAEBCGMABAIDAgRlAAMGAgMGawoBBgcCBgdrAAcFBQdjCQEBAAIEAQJfAAUAAAVUAAUFAFcAAAUASxtLsB5QWEA8CwEIAQhvAAQCAwIEZQADBgIDBmsKAQYHAgYHawAHBQIHBWsJAQEAAgQBAl8ABQAABVQABQUAVwAABQBLG0A9CwEIAQhvAAQCAwIEA20AAwYCAwZrCgEGBwIGB2sABwUCBwVrCQEBAAIEAQJfAAUAAAVUAAUFAFcAAAUAS1lZWUAgHh4WFQAAHiUeJRoZFR0WHRIRDAsHBgUEAAMAAxEMBRUrAREhERcjFTMFNC4BIg4BFB4BMj4BJyIGFBYyNjQmATcFBxUTAQMC7v0S0H19AcstTVpNLS1NWk0tpyIxMUQxMP8AQwIkPaf9QGoBsf3jAh1TU30tTC0tTFpNLS1NgDBGMTFGMAEkucin8wHMAQD+3QAFAAD/agPoA1IACwAbACkAOQBRADtAOFBDMh0VCwYAAjMUAgEAAkcrIyINBgUGAkUAAgACbwAAAQBvBAMCAQFmOjo6UTpRSklCQT49BQUUKwE+ATQmJzceARQGBwEnBgcGFBcWFzcmJyY0NzYTNy4BNDY3JwYHBhQXFgEHFhcWFAcGBxc2NzY0JyYBEz4BMhYXEzMDPgE1NC4BIg4BFRQWFwMCmBsdHRtBKCwsKP31QkMkJSUkQ0I2HR4eHXdBGx0dG0EoFRcXFQJ1QjYdHh4dNkJDJCUlJf2yfQQWGhYEfVrUJS4iOUQ5Ii4l0gFyIE1STSA8K2x2aywB4DxDU1e6V1NDPDhERphGRP5YPCBNUk0gPCw0N3Y2NAHvPDhERphGRDg8RFNWulZU/FsBRQwODgz+uwIpDUAoIjkiIjkiKEAN/dcAAAAADQAA/9YDoALmAAMABwALAA8AEwAXABsAHwAjACcAKwAvADMAjECJGgEBGQ8CCwoBC14YAQoXAQkICgleFgEIFQEHDggHXgAOAA0GDg1eFAEGEwEFBAYFXhIBBBEBAwIEA14QDAICAAACUhAMAgICAFYAAAIASgAAMzIxMC8uLSwrKikoJyYlJCMiISAfHh0cGxoZGBcWFRQTEhEQDw4NDAsKCQgHBgUEAAMAAxEbBRUrExEhEQEjNTM1IzUzNSM1MzUjNTM1IzUzASERITUhESETIzUzNSM1MzUjNTM1IzUzNSM1M0gDWP03SEhISEhISEhISAHz/lQBrP5UAayPSEhISEhISEhISALm/PADEP03R0hHR0hHR0hH/X4BHUgBHf1+R0hHR0hHR0hHAAAAAAEAAP9qAogDUgAIACRACQgHBAMCAQYAREuwJFBYtQAAAAwASRuzAAAAZlmzFQEFFSsFByc3FxEzETcCiJSULEk/SAKUlC1IA2/8kUgAAAAAAQAAAAAD6AHyAAgAKEAlBAEAAQFHBgUCAUUDAgIARAABAAABUgABAQBWAAABAEoWEAIFFisBIRcHJzcXByED6PyRSC2UlC1IA28BP0kslJQsSAAAAQAAAAAD6AHyAAgAJ0AkCAEBAAFHAQEARQcGAgFEAAABAQBSAAAAAVYAAQABShESAgUWKwEHFyEVIQcXNwNULUj8kQNvSC2UAfIsSD9JLJQAAAAAAQAA/2oCiANSAAgAFEARCAcGBQIBBgBFAAAAZhMBBRUrAQcnESMRByc3AogsSD9JLJQCvi1I/JEDb0gtlAAAAAMAAP/oA7EClwADAAcACwAyQC8GAQUABAMFBF4AAwACAQMCXgABAAABUgABAQBWAAABAEoICAgLCAsSEREREAcFGSsXITUhNSE1IREVITU6A3f8iQN3/IkDdxhyrHMBHnNzAAAFAAD/5wPoAtUACAARABUAGQAhALZLsA9QWEBBDgELCgtvAAoECm8ACAUJBQhlAAMAA3AABAAGBwQGXgAHDQEFCAcFXgAJDAECAQkCYAABAAABVAABAQBYAAABAEwbQEIOAQsKC28ACgQKbwAIBQkFCAltAAMAA3AABAAGBwQGXgAHDQEFCAcFXgAJDAECAQkCYAABAAABVAABAQBYAAABAExZQCUaGhISCgkaIRohIB8eHRwbGRgXFhIVEhUUEw4NCREKERMSDwUWKyUUBiImNDYyFjciBhQWMjY0JiUDIQMnIRchAQMhFyETMzcBoSU0JCUzJZIaJSU0JCT+LXoCvVMc/i81AXkBDo/98yMCKJFQHyYaJSU0JCUlJDQlJTQk0AEk/tzRfQFN/gxTAfRTAAAAAAEAAAABAAAhi48eXw889QALA+gAAAAA1D40PgAAAADUPjQ//9P/TwUGA2AAAAAIAAIAAAAAAAAAAQAAA1L/agAABQX/0//cBQYAAQAAAAAAAAAAAAAAAAAAATsD6AAAA+gAAAKCAAADhAAAA+gAAAOEAAAD1AAAA+gAAAPoAAADmAAAAjAAAAOEAAADhAAABC///wPC//wDrAAAA6wAAAM0//4DLQAAA1n//QNZ//0DWf/9A6AAAAMRAAACvAAAA+j//wPo//8DIP//A4QAAAQv//8COwAAAsoAAALKAAADoAAAA1n//QGsAAACgv//BC///wQv//8DWQAABC8AAAKCAAADoAAAA1kAAAKCAAADhAAAA+j//QPo//8D6P/6A+n//wPoAAAD6P/wAfQAAAPoAAACggAAAWUAAAFlAAAD6P/0A+gAAAPoAAAD6AAAANwAAAPr//YD6P//A+j//wOpAAAD6AAAAu4AAAPmAAAD6gAAA+j//wPoAAAD6AAAAu4AAANrAAADawAAA+gAAAPoAAADa///A+gAAAPoAAACsAAAA+j//gPoAAADyQAAA+gAAAPoAAAD6AAAA+j//wPo/9wD6AAAA+j/9gKv//8CrwAAA+gAAAPo//8D6QAAA+j//wPoAAAD6f/5A+gAAAPoAAAD6P/4A+j//wPo//8EdgAAAxEAAAR2AAAD6AAAA+gAAANZAAAEdgAAA1n//QI7AAAD6AAAA1kAAAI7AAADWQAAAsoAAAPoAAADoAAAA1n//QNZ//8FBQAAA+gAAANZAAADEQAAA1kAAAR2AAADWQAABHYAAAPoAAADWQAAA1kAAAPoAAADWQAAA+gAAAMR//8DWQAAA+gAAAPoAAADWQAAA1kAAAOgAAAD6AAABQUAAANZ//0CygAAA1kAAAPoAAAELwAAAsoAAANZAAACOwAAA+gAAAOgAAADWQAABC///wR2AAAD6P/+A6AAAAPo//4DEf/+A1kAAANZAAADWQAAA1kAAANZAAADWQAAA+gAAAOgAAAD6AAAApv//QHWAAACRAAAAkQAAAI7AAACOwAAAoIAAAKCAAACRAAAAcwAAAMgAAAC+gAAA6v//gPoAAADwP/+ArwAAAMMAAACuv/gA+gAAAOE//wD6AAAA+j/+APUAAAD6AAAA6wAAAPoAAAD6AAAA+gAAAPoAAADoAAAAjoAAAOYAAACRv/zAyv/0wLk//YDIAAAA1kAAANZAAADWQAAA1kAAANZAAADWQAAA1kAAANZAAADWQAAA1kAAANZAAADEQAAAxEAAAOgAAAD6AAAA+gAAAOEAAADwv/6AfQAAAJYAAACEgAAArwAAAJYAAAD6P/6A+gAAAJYAAADcAAAA3AAAAPoAAAD6AAAAxEAAAOgAAADWQAAA1kAAAOgAAADMQAAA+gAAAOp//8D6AAAA+gAAAPoAAAD6AAAA+gAAAPoAAAD6AAAA+gAAAPoAAAD6AAAA+gAAAPoAAADoAAAA6AAAAPoAAAD6AAAA+gAAANEAAAD6P//A+gAAANZAAADWQAAA+gAAAPoAAAD6AAAA+gAAAGs//0D6AAAA+gAAAGs//4D6AAAA+b/8wKv//8D6AAAA+gAAAPoAAAD6AAAA+gAAAPoAAAD6AAAA+gAAAPoAAAD6AAAA+gAAAPoAAAD6AAAA+gAAAPoAAADYv/zAdH/9AHR//MDYP/0A+gAAAPoAAAD6AAAA+gAAAPoAAAD6AAAA+gAAAPoAAAD6AAAA+gAAAPoAAAD6AAAA+gAAAPoAAAD6AAAA+gAAAPoAAAAAAAAAIYA7AEcAVoBiAIWAtIC7ANCBAwEpAU4BbIF8AY6BoQG0AfOCBIIagiMCRgJYgmqCjoKqgr0C1QMQgyqDSgNig3OEdQSQBKyEyoTohRkFggWPhamF2IXqhgyGPAaAhsGG5YdTB2yHfIeUB6GHroe7h+WICogmiEKIS4htiIqIsgjtCQYJMYlVCXEJ5QodikAKYwqPitOLM4tmC6CL4QwJDDaMTwxsjLSM2I0TjS+NWo20DeuOCw43jo6Ovw79DzQPf5APEF4QzpE7kbER75IuEm2SmhLaEviTBxMaEzwTbxOEE5WT2hPtlAGUJ5R6FKOUtxTLlOiVCRUbFS2VZBWRFcSV7RYUFzGXSxdal4YXk5fFF+sYG5hUmGQYkZjCmPUZaRmTmaqZyJnsGgWaLhpImmCagBqcGr6a9pslm1ibaJunm8Ab7ByKHKAczZzXHPudGJ0tHT0dSR1ZHWcdb52FnZuds53LneceBR4knjweVp5wHoienp6uHsme157mnwifIR86n10fcJ+Nn62f3KAKoCEgLqBBIFAggKCNIKSgv6D1IT0heyG8IgqiMqKOItkjBSM7I2wjlyOzI+6kGKQmpDgkP6RIpFSkXSRppJOkpaSxJL0kyiTnJO2lCiUbJSylPiVPJVolbSWFpbQl56ceqA6oLahOKIio2akBKTSpbqncKeup+yoPqiWqNipDKlOqYqqcqs+rCyuBK+UsBSwWLCMsMKw+LFiskay4LMEtGC02LVgtk62jrdOt+C5arpeuu67lLvovJy9Zr2Kva690r30voa/Er+swQDBUMHqw3zEOMUexcLGWsaCxqzG1sb2xyjHwQABAAABOwH5ABkAAAAAAAIAXABsAHMAAAH+C3AAAAAAAAAAEgDeAAEAAAAAAAAANQAAAAEAAAAAAAEACAA1AAEAAAAAAAIABwA9AAEAAAAAAAMACABEAAEAAAAAAAQACABMAAEAAAAAAAUACwBUAAEAAAAAAAYACABfAAEAAAAAAAoAKwBnAAEAAAAAAAsAEwCSAAMAAQQJAAAAagClAAMAAQQJAAEAEAEPAAMAAQQJAAIADgEfAAMAAQQJAAMAEAEtAAMAAQQJAAQAEAE9AAMAAQQJAAUAFgFNAAMAAQQJAAYAEAFjAAMAAQQJAAoAVgFzAAMAAQQJAAsAJgHJQ29weXJpZ2h0IChDKSAyMDE2IGJ5IG9yaWdpbmFsIGF1dGhvcnMgQCBmb250ZWxsby5jb21mb250ZWxsb1JlZ3VsYXJmb250ZWxsb2ZvbnRlbGxvVmVyc2lvbiAxLjBmb250ZWxsb0dlbmVyYXRlZCBieSBzdmcydHRmIGZyb20gRm9udGVsbG8gcHJvamVjdC5odHRwOi8vZm9udGVsbG8uY29tAEMAbwBwAHkAcgBpAGcAaAB0ACAAKABDACkAIAAyADAAMQA2ACAAYgB5ACAAbwByAGkAZwBpAG4AYQBsACAAYQB1AHQAaABvAHIAcwAgAEAAIABmAG8AbgB0AGUAbABsAG8ALgBjAG8AbQBmAG8AbgB0AGUAbABsAG8AUgBlAGcAdQBsAGEAcgBmAG8AbgB0AGUAbABsAG8AZgBvAG4AdABlAGwAbABvAFYAZQByAHMAaQBvAG4AIAAxAC4AMABmAG8AbgB0AGUAbABsAG8ARwBlAG4AZQByAGEAdABlAGQAIABiAHkAIABzAHYAZwAyAHQAdABmACAAZgByAG8AbQAgAEYAbwBuAHQAZQBsAGwAbwAgAHAAcgBvAGoAZQBjAHQALgBoAHQAdABwADoALwAvAGYAbwBuAHQAZQBsAGwAbwAuAGMAbwBtAAAAAAIAAAAAAAAACgAAAAAAAAAAAAAAAAAAAAAAAAAAAAABOwECAQMBBAEFAQYBBwEIAQkBCgELAQwBDQEOAQ8BEAERARIBEwEUARUBFgEXARgBGQEaARsBHAEdAR4BHwEgASEBIgEjASQBJQEmAScBKAEpASoBKwEsAS0BLgEvATABMQEyATMBNAE1ATYBNwE4ATkBOgE7ATwBPQE+AT8BQAFBAUIBQwFEAUUBRgFHAUgBSQFKAUsBTAFNAU4BTwFQAVEBUgFTAVQBVQFWAVcBWAFZAVoBWwFcAV0BXgFfAWABYQFiAWMBZAFlAWYBZwFoAWkBagFrAWwBbQFuAW8BcAFxAXIBcwF0AXUBdgF3AXgBeQF6AXsBfAF9AX4BfwGAAYEBggGDAYQBhQGGAYcBiAGJAYoBiwGMAY0BjgGPAZABkQGSAZMBlAGVAZYBlwGYAZkBmgGbAZwBnQGeAZ8BoAGhAaIBowGkAaUBpgGnAagBqQGqAasBrAGtAa4BrwGwAbEBsgGzAbQBtQG2AbcBuAG5AboBuwG8Ab0BvgG/AcABwQHCAcMBxAHFAcYBxwHIAckBygHLAcwBzQHOAc8B0AHRAdIB0wHUAdUB1gHXAdgB2QHaAdsB3AHdAd4B3wHgAeEB4gHjAeQB5QHmAecB6AHpAeoB6wHsAe0B7gHvAfAB8QHyAfMB9AH1AfYB9wH4AfkB+gH7AfwB/QH+Af8CAAIBAgICAwIEAgUCBgIHAggCCQIKAgsCDAINAg4CDwIQAhECEgITAhQCFQIWAhcCGAIZAhoCGwIcAh0CHgIfAiACIQIiAiMCJAIlAiYCJwIoAikCKgIrAiwCLQIuAi8CMAIxAjICMwI0AjUCNgI3AjgCOQI6AjsCPAAFdmNhcmQDcGluBXJlcGx5CXJlcGx5LWFsbAdmb3J3YXJkBXByaW50CGtleWJvYXJkC3NsaWRlci1sZWZ0C2Nsb2NrLWVtcHR5CWhvdXJnbGFzcwVsb2dpbgZsb2dvdXQHcGljdHVyZQVicnVzaANjY3cCY3cHcmVmcmVzaAVjbG9jawxjaXJjbGUtZW1wdHkKY2lyY2xlLWRvdAZjaXJjbGUIY2hlY2tib3gOY2hlY2tib3gtZW1wdHkEYm9vawptYWlsLWVtcHR5BG1haWwFcGhvbmUJYm9vay1vcGVuC3VzZXJzLWdyb3VwBG1hbGUGZmVtYWxlBWNoaWxkBHN0YXIFZ2xvYmUGbW9iaWxlCHRhYmxldC0xBmxhcHRvcAdkZXNrdG9wA2NvZwRjb2dzBGRvd24Gd3JlbmNoB3NsaWRlcnMEbG9jawZ0cm9waHkFc3BpbjMFc3BpbjEFc3BpbjIFc3BpbjQFc3BpbjUFc3BpbjYIbG9jYXRpb24HYWRkcmVzcwJ1cAVyaWdodARsZWZ0C211c2ljLWxpZ2h0DHNlYXJjaC1saWdodAptYWlsLWxpZ2h0C2hlYXJ0LWxpZ2h0A2RvdAp1c2VyLWxpZ2h0C3ZpZGVvLWxpZ2h0DGNhbWVyYS1saWdodAtwaG90by1saWdodAxhdHRhY2gtbGlnaHQKbG9jay1saWdodAlleWUtbGlnaHQJdGFnLWxpZ2h0D3RodW1icy11cC1saWdodAxwZW5jaWwtbGlnaHQNY29tbWVudC1saWdodA5sb2NhdGlvbi1saWdodAljdXAtbGlnaHQLdHJhc2gtbGlnaHQJZG9jLWxpZ2h0CWtleS1saWdodA5kYXRhYmFzZS1saWdodA9tZWdhcGhvbmUtbGlnaHQQZ3JhZHVhdGlvbi1saWdodApmaXJlLWxpZ2h0EXBhcGVyLXBsYW5lLWxpZ2h0C2Nsb3VkLWxpZ2h0C2dsb2JlLWxpZ2h0C2luYm94LWxpZ2h0BGNhcnQFaWNvbjENZGVza3RvcC1saWdodAh0di1saWdodAx3YWxsZXQtbGlnaHQNdC1zaGlydC1saWdodA9saWdodGJ1bGItbGlnaHQLY2xvY2stbGlnaHQNZGlhbW9uZC1saWdodApzaG9wLWxpZ2h0C3NvdW5kLWxpZ2h0DmNhbGVuZGFyLWxpZ2h0CmZvb2QtbGlnaHQLbW9uZXktbGlnaHQMcGFyYW1zLWxpZ2h0CWNvZy1saWdodAxiZWFrZXItbGlnaHQKbm90ZS1saWdodAt0cnVjay1saWdodAdiZWhhbmNlCWJpdGJ1Y2tldAJjYwhjb2Rlb3BlbgRjc3MzCWRlbGljaW91cwRkaWdnCGRyaWJiYmxlCmRldmlhbnRhcnQHZHJvcGJveAZkcnVwYWwIZmFjZWJvb2sGZmxpY2tyCmZvdXJzcXVhcmUDZ2l0BmdpdGh1YgZnaXR0aXAGZ29vZ2xlBWdwbHVzB2d3YWxsZXQLaGFja2VyLW5ld3MFaHRtbDUKaW5zdGFncmFtbQdpb3hob3N0Bmpvb21sYQhqc2ZpZGRsZQZsYXN0Zm0FbGludXgIbGlua2VkaW4GbWF4Y2RuCG1lYW5wYXRoBm9wZW5pZAlwYWdlbGluZXMGcGF5cGFsAnFxBnJlZGRpdAZyZW5yZW4Fc2t5cGUFc2xhY2sKc2xpZGVzaGFyZQpzb3VuZGNsb3VkB3Nwb3RpZnkNc3RhY2tleGNoYW5nZQ1zdGFja292ZXJmbG93BXN0ZWFtC3N0dW1ibGV1cG9uDXRlbmNlbnQtd2VpYm8GdHJlbGxvBnR1bWJscgZ0d2l0Y2gHdHdpdHRlcgR2aW5lCXZrb250YWt0ZQZ3ZWNoYXQFd2VpYm8Hd2luZG93cwl3b3JkcHJlc3MEeGluZwR5ZWxwB3lvdXR1YmUFeWFob28FbGVtb24FYmxhbmsRcGludGVyZXN0LWNpcmNsZWQLaGVhcnQtZW1wdHkJbG9jay1vcGVuBWhlYXJ0BWNoZWNrBmNhbmNlbARwbHVzBW1pbnVzC2RvdWJsZS1sZWZ0DGRvdWJsZS1yaWdodAlkb3VibGUtdXALZG91YmxlLWRvd24EaGVscARpbmZvBGxpbmsFcXVvdGUGYXR0YWNoA2V5ZQN0YWcEbWVudQZwZW5jaWwHZmVhdGhlcgRjb2RlBGhvbWUGY2FtZXJhCHBpY3R1cmVzBXZpZGVvBXVzZXJzBHVzZXIIdXNlci1hZGQNY29tbWVudC1lbXB0eQpjaGF0LWVtcHR5BGJlbGwKc3Rhci1lbXB0eQRkb3QyBGRvdDMEbm90ZQZiYXNrZXQFbm90ZTIFc2hhcmUDZG9jCGRvYy10ZXh0CGZpbGUtcGRmCWZpbGUtd29yZApmaWxlLWV4Y2VsD2ZpbGUtcG93ZXJwb2ludApmaWxlLWltYWdlDGZpbGUtYXJjaGl2ZQpmaWxlLWF1ZGlvCmZpbGUtdmlkZW8JZmlsZS1jb2RlC3RyYXNoLWVtcHR5BXRyYXNoCHRoLWxhcmdlAnRoB3RoLWxpc3QEZmxhZwlhdHRlbnRpb24EcGxheQRzdG9wBXBhdXNlBnJlY29yZAZ0by1lbmQFdG9vbHMHcmV0d2VldAh0by1zdGFydAxmYXN0LWZvcndhcmQNZmFzdC1iYWNrd2FyZAZzZWFyY2gMc2xpZGVyLXJpZ2h0A3Jzcwpkb3duLWJpZy0xCmxlZnQtYmlnLTELcmlnaHQtYmlnLTEIdXAtYmlnLTEJY29tbWVudC0yB2NvbW1lbnQFZXllLTIGdGFibGV0B2JhdGh0dWIEY29tYghjYWxlbmRhcgpzZWFyY2gtYWx0BXdoaXRlCGhvbWUtYWx0BXRpbWVyB2xvY2F0b3IDY3VwCGN1cnJlbmN5A2JveApxdW90ZS1sZWZ0C3F1b3RlLXJpZ2h0CXZvbHVtZS11cAp2b2x1bWUtb2ZmBnZvbHVtZQt2b2x1bWUtZG93bg5hcnJvdy1sZWZ0LWFsdA9hcnJvdy1yaWdodC1hbHQJdGh1bWJzLXVwC3RodW1icy1kb3duBnNwZWVjaAZzcGhlcmUFbGlnaHQLYXBwbGUtbW91c2UKYXJyb3ctZG93bgphcnJvdy1sZWZ0C2Fycm93LXJpZ2h0CGFycm93LXVwCHNlYXJjaC0yCGNkLWxpZ2h0DG1vYmlsZS1saWdodAxjbGVhci1idXR0b24KYmlub2N1bGFycwVpY29uMgdwaG9uZS0xCWNsaXBib2FyZAVlbWFpbAVtb2RlbQdwYXJraW5nDXN3aW1taW5nLXBvb2wGc3VtbWVyEHdpcmVsZXNzLWFudGVubmEFZmxvb3IGaG9tZS0yCHdpcmVsZXNzB2lyb25pbmcIZG93bi1iaWcIbGVmdC1iaWcJcmlnaHQtYmlnBnVwLWJpZwdsYXVuZHJ5BWZheC0yB3Bob25lLTIHdG9vbHMtMgpjaGVja2JveC0yA21hcAluZXdzcGFwZXIGbm90ZS0yCXBpY3R1cmUtMgtyYWRpby10b3dlcgd2aWRlby0yCmRvd24tYXJyb3cKbGVmdC1hcnJvdwtyaWdodC1hcnJvdwh1cC1hcnJvdwZtZW51LTIGY2FydC0yAAAAAAAAAQAB//8ADwAAAAAAAAAAAAAAAAAAAAAAGAAYABgAGANg/08DYP9PsAAsILAAVVhFWSAgS7gADlFLsAZTWliwNBuwKFlgZiCKVViwAiVhuQgACABjYyNiGyEhsABZsABDI0SyAAEAQ2BCLbABLLAgYGYtsAIsIGQgsMBQsAQmWrIoAQpDRWNFUltYISMhG4pYILBQUFghsEBZGyCwOFBYIbA4WVkgsQEKQ0VjRWFksChQWCGxAQpDRWNFILAwUFghsDBZGyCwwFBYIGYgiophILAKUFhgGyCwIFBYIbAKYBsgsDZQWCGwNmAbYFlZWRuwAStZWSOwAFBYZVlZLbADLCBFILAEJWFkILAFQ1BYsAUjQrAGI0IbISFZsAFgLbAELCMhIyEgZLEFYkIgsAYjQrEBCkNFY7EBCkOwAWBFY7ADKiEgsAZDIIogirABK7EwBSWwBCZRWGBQG2FSWVgjWSEgsEBTWLABKxshsEBZI7AAUFhlWS2wBSywB0MrsgACAENgQi2wBiywByNCIyCwACNCYbACYmawAWOwAWCwBSotsAcsICBFILALQ2O4BABiILAAUFiwQGBZZrABY2BEsAFgLbAILLIHCwBDRUIqIbIAAQBDYEItsAkssABDI0SyAAEAQ2BCLbAKLCAgRSCwASsjsABDsAQlYCBFiiNhIGQgsCBQWCGwABuwMFBYsCAbsEBZWSOwAFBYZVmwAyUjYUREsAFgLbALLCAgRSCwASsjsABDsAQlYCBFiiNhIGSwJFBYsAAbsEBZI7AAUFhlWbADJSNhRESwAWAtsAwsILAAI0KyCwoDRVghGyMhWSohLbANLLECAkWwZGFELbAOLLABYCAgsAxDSrAAUFggsAwjQlmwDUNKsABSWCCwDSNCWS2wDywgsBBiZrABYyC4BABjiiNhsA5DYCCKYCCwDiNCIy2wECxLVFixBGREWSSwDWUjeC2wESxLUVhLU1ixBGREWRshWSSwE2UjeC2wEiyxAA9DVVixDw9DsAFhQrAPK1mwAEOwAiVCsQwCJUKxDQIlQrABFiMgsAMlUFixAQBDYLAEJUKKiiCKI2GwDiohI7ABYSCKI2GwDiohG7EBAENgsAIlQrACJWGwDiohWbAMQ0ewDUNHYLACYiCwAFBYsEBgWWawAWMgsAtDY7gEAGIgsABQWLBAYFlmsAFjYLEAABMjRLABQ7AAPrIBAQFDYEItsBMsALEAAkVUWLAPI0IgRbALI0KwCiOwAWBCIGCwAWG1EBABAA4AQkKKYLESBiuwcisbIlktsBQssQATKy2wFSyxARMrLbAWLLECEystsBcssQMTKy2wGCyxBBMrLbAZLLEFEystsBossQYTKy2wGyyxBxMrLbAcLLEIEystsB0ssQkTKy2wHiwAsA0rsQACRVRYsA8jQiBFsAsjQrAKI7ABYEIgYLABYbUQEAEADgBCQopgsRIGK7ByKxsiWS2wHyyxAB4rLbAgLLEBHistsCEssQIeKy2wIiyxAx4rLbAjLLEEHistsCQssQUeKy2wJSyxBh4rLbAmLLEHHistsCcssQgeKy2wKCyxCR4rLbApLCA8sAFgLbAqLCBgsBBgIEMjsAFgQ7ACJWGwAWCwKSohLbArLLAqK7AqKi2wLCwgIEcgILALQ2O4BABiILAAUFiwQGBZZrABY2AjYTgjIIpVWCBHICCwC0NjuAQAYiCwAFBYsEBgWWawAWNgI2E4GyFZLbAtLACxAAJFVFiwARawLCqwARUwGyJZLbAuLACwDSuxAAJFVFiwARawLCqwARUwGyJZLbAvLCA1sAFgLbAwLACwAUVjuAQAYiCwAFBYsEBgWWawAWOwASuwC0NjuAQAYiCwAFBYsEBgWWawAWOwASuwABa0AAAAAABEPiM4sS8BFSotsDEsIDwgRyCwC0NjuAQAYiCwAFBYsEBgWWawAWNgsABDYTgtsDIsLhc8LbAzLCA8IEcgsAtDY7gEAGIgsABQWLBAYFlmsAFjYLAAQ2GwAUNjOC2wNCyxAgAWJSAuIEewACNCsAIlSYqKRyNHI2EgWGIbIVmwASNCsjMBARUUKi2wNSywABawBCWwBCVHI0cjYbAJQytlii4jICA8ijgtsDYssAAWsAQlsAQlIC5HI0cjYSCwBCNCsAlDKyCwYFBYILBAUVizAiADIBuzAiYDGllCQiMgsAhDIIojRyNHI2EjRmCwBEOwAmIgsABQWLBAYFlmsAFjYCCwASsgiophILACQ2BkI7ADQ2FkUFiwAkNhG7ADQ2BZsAMlsAJiILAAUFiwQGBZZrABY2EjICCwBCYjRmE4GyOwCENGsAIlsAhDRyNHI2FgILAEQ7ACYiCwAFBYsEBgWWawAWNgIyCwASsjsARDYLABK7AFJWGwBSWwAmIgsABQWLBAYFlmsAFjsAQmYSCwBCVgZCOwAyVgZFBYIRsjIVkjICCwBCYjRmE4WS2wNyywABYgICCwBSYgLkcjRyNhIzw4LbA4LLAAFiCwCCNCICAgRiNHsAErI2E4LbA5LLAAFrADJbACJUcjRyNhsABUWC4gPCMhG7ACJbACJUcjRyNhILAFJbAEJUcjRyNhsAYlsAUlSbACJWG5CAAIAGNjIyBYYhshWWO4BABiILAAUFiwQGBZZrABY2AjLiMgIDyKOCMhWS2wOiywABYgsAhDIC5HI0cjYSBgsCBgZrACYiCwAFBYsEBgWWawAWMjICA8ijgtsDssIyAuRrACJUZSWCA8WS6xKwEUKy2wPCwjIC5GsAIlRlBYIDxZLrErARQrLbA9LCMgLkawAiVGUlggPFkjIC5GsAIlRlBYIDxZLrErARQrLbA+LLA1KyMgLkawAiVGUlggPFkusSsBFCstsD8ssDYriiAgPLAEI0KKOCMgLkawAiVGUlggPFkusSsBFCuwBEMusCsrLbBALLAAFrAEJbAEJiAuRyNHI2GwCUMrIyA8IC4jOLErARQrLbBBLLEIBCVCsAAWsAQlsAQlIC5HI0cjYSCwBCNCsAlDKyCwYFBYILBAUVizAiADIBuzAiYDGllCQiMgR7AEQ7ACYiCwAFBYsEBgWWawAWNgILABKyCKimEgsAJDYGQjsANDYWRQWLACQ2EbsANDYFmwAyWwAmIgsABQWLBAYFlmsAFjYbACJUZhOCMgPCM4GyEgIEYjR7ABKyNhOCFZsSsBFCstsEIssDUrLrErARQrLbBDLLA2KyEjICA8sAQjQiM4sSsBFCuwBEMusCsrLbBELLAAFSBHsAAjQrIAAQEVFBMusDEqLbBFLLAAFSBHsAAjQrIAAQEVFBMusDEqLbBGLLEAARQTsDIqLbBHLLA0Ki2wSCywABZFIyAuIEaKI2E4sSsBFCstsEkssAgjQrBIKy2wSiyyAABBKy2wSyyyAAFBKy2wTCyyAQBBKy2wTSyyAQFBKy2wTiyyAABCKy2wTyyyAAFCKy2wUCyyAQBCKy2wUSyyAQFCKy2wUiyyAAA+Ky2wUyyyAAE+Ky2wVCyyAQA+Ky2wVSyyAQE+Ky2wViyyAABAKy2wVyyyAAFAKy2wWCyyAQBAKy2wWSyyAQFAKy2wWiyyAABDKy2wWyyyAAFDKy2wXCyyAQBDKy2wXSyyAQFDKy2wXiyyAAA/Ky2wXyyyAAE/Ky2wYCyyAQA/Ky2wYSyyAQE/Ky2wYiywNysusSsBFCstsGMssDcrsDsrLbBkLLA3K7A8Ky2wZSywABawNyuwPSstsGYssDgrLrErARQrLbBnLLA4K7A7Ky2waCywOCuwPCstsGkssDgrsD0rLbBqLLA5Ky6xKwEUKy2wayywOSuwOystsGwssDkrsDwrLbBtLLA5K7A9Ky2wbiywOisusSsBFCstsG8ssDorsDsrLbBwLLA6K7A8Ky2wcSywOiuwPSstsHIsswkEAgNFWCEbIyFZQiuwCGWwAyRQeLABFTAtAEu4AMhSWLEBAY5ZsAG5CAAIAGNwsQAFQrIAAQAqsQAFQrMKAgEIKrEABUKzDgABCCqxAAZCugLAAAEACSqxAAdCugBAAAEACSqxAwBEsSQBiFFYsECIWLEDZESxJgGIUVi6CIAAAQRAiGNUWLEDAERZWVlZswwCAQwquAH/hbAEjbECAEQAAA==") format("truetype");}@font-face{font-family:"Abril Fatface";font-style:normal;font-weight:400;src:url("https://fonts.gstatic.com/s/abrilfatface/v19/zOL64pLDlL1D99S8g8PtiKchq-lmjcDidBeT5g.woff2") format("woff2");unicode-range:U+0100-024F,U+0259,U+1E00-1EFF,U+2020,U+20A0-20AB,U+20AD-20CF,U+2113,U+2C60-2C7F,U+A720-A7FF;}@font-face{font-family:"Abril Fatface";font-style:normal;font-weight:400;src:url("https://fonts.gstatic.com/s/abrilfatface/v19/zOL64pLDlL1D99S8g8PtiKchq-dmjcDidBc.woff2") format("woff2");unicode-range:U+0000-00FF,U+0131,U+0152-0153,U+02BB-02BC,U+02C6,U+02DA,U+02DC,U+2000-206F,U+2074,U+20AC,U+2122,U+2191,U+2193,U+2212,U+2215,U+FEFF,U+FFFD;}@font-face{font-family:FontAwesome;font-weight:400;font-style:normal;src:url("data:font/woff2;fontawesome-webfont.woff2;base64,d09GMgABAAAAAAHoAAoAAAAAA8QAAAGfAAEAAAAAAAAAAAAAAAAAAAAAAAAAAAAABmAARAqBGIEYCwoAATYCJAMQBCAFgiIHIBsHAyAuh3cESYfNidQheEq5aWcySfsaI10hw3AE5FpucnlA9SWHEi2QkWVfB4jjUcn6KvJV8n/an+++51CvbUlMMG+QUnYDJIT/74WHGVCEi/suUIoh8RGugQGu6ve/QfNds53O5O821oEmdTMOLOg8wkACT4IKOAo1wN4JhoQoOc/WIcsvoWcs6T4VuNS6cQ0g3NL7lm+5AgfcXprICxAA0AkhIkMDLaCBMQQUFUV0+rcHOexT9AUCAAkUkaEPGAYggQhCSr2T7Um3T4qdE9xTlkYvxLc/ga4KdPJbkWVMcveNqo38z2A78ewzzgeO6e2kmuohkdcBICCFr0/s1RVjFyiAv65Hz2KFPD7cJpDXRAlpHhLYyI7N5xMUkDsGAlLsSAkUpjAFAAWzaCGVsAhSBK1qiOrWken2zNMYcnq9LN96221m7mBpoKdvDfNo2iIwv6apjgNMT0vHTA1zGhvDi7YqBBIScQd+2KHmMzO15rRDrMxMEClEz8ZY05JPXExGhJOLXVyGj1dBQlxKRg6xtDIwM4UZqVmoaR9WTjM=") format("woff2");}</style><script nitro-exclude>(function(){const e=document.createElement("link");if(!(e.relList&&e.relList.supports&&e.relList.supports("prefetch"))){return}let r=document.cookie.includes("9d63262f59cd9b3378f01392c");let c={initNP_PPL:function(){if(window.NP_PPL!==undefined)return;window.NP_PPL={prefetches:[],lcpEvents:[],other:[]}},logPrefetch:function(e,t){let n=JSON.parse(window.sessionStorage.getItem("nitro_prefetched_urls"));if(n===null)n={};if(n[e]===undefined){n[e]=t;window.sessionStorage.setItem("nitro_prefetched_urls",JSON.stringify(n))}if(!r)return;window.NP_PPL.prefetches.push({url:e,initiator:t,timestamp:performance.now()})},logLcpEvent:function(e,t=null){if(!r)return;window.NP_PPL.lcpEvents.push({message:e,data:t,timestamp:performance.now()})},logOther:function(e,t=null){if(!r)return;window.NP_PPL.other.push({message:e,data:t,timestamp:performance.now()})}};if(r){c.initNP_PPL()}let o=0;const t=300;let n=".chirurgies-esthetique-entunisie.com";let l=new RegExp(n+"$");function a(){return performance.now()-o>t}function u(){let n;let r=performance.now();const e={capture:true,passive:true};document.addEventListener("touchstart",t,e);document.addEventListener("mouseover",o,e);function t(e){r=performance.now();const t=e.target.closest("a");if(!t||!s(t)){return}g(t.href,"TOUCH")}function o(e){c.logOther("mouseoverListener() called",e);if(performance.now()-r<1111){return}const t=e.target.closest("a");if(!t||!s(t)){return}t.addEventListener("mouseout",l,{passive:true});n=setTimeout(function(){c.logOther("mouseoverTimer CALLBACK called",e);g(t.href,"HOVER");n=undefined},85)}function l(e){if(e.relatedTarget&&e.target.closest("a")==e.relatedTarget.closest("a")){return}if(n){clearTimeout(n);n=undefined}}}function f(){if(!PerformanceObserver.supportedEntryTypes.includes("largest-contentful-paint")){c.logLcpEvent("PerformanceObserver does not support LCP events in this browser.");return}let e=new PerformanceObserver(e=>{c.logLcpEvent("LCP_DETECTED",e.getEntries().at(-1).element);_=e.getEntries().at(-1).element});let t=function(e){b=window.requestIdleCallback(E);window.removeEventListener("load",t)};k.forEach(e=>{window.addEventListener(e,w,{once:true})});e.observe({type:"largest-contentful-paint",buffered:true});window.addEventListener("load",t)}function s(t){if(!t){c.logOther("Link Not Prefetchable: empty link element.",t);return false}if(!t.href){c.logOther("Link Not Prefetchable: empty href attribute.",t);return false}let e=t.href;let n=null;try{n=new URL(e)}catch(e){c.logOther("Link Not Prefetchable: "+e,t);return false}let r="."+n.hostname.replace("www.","");if(!["http:","https:"].includes(t.protocol)){c.logOther("Link Not Prefetchable: missing protocol in the URL.",t);return false}if(t.protocol=="http:"&&location.protocol=="https:"){c.logOther("Link Not Prefetchable: URL is HTTP but the current page is HTTPS.",t);return false}if(t.getAttribute("href").charAt(0)=="#"||t.hash&&t.pathname+t.search==location.pathname+location.search){c.logOther("Link Not Prefetchable: URL is the current location but with a hash.",t);return false}if(l.exec(r)===null){c.logOther("Link Not Prefetchable: Different domain.",t);return false}for(i=0;i<y.length;i++){if(e.match(y[i])!==null){c.logOther("Link Not Prefetchable: Excluded URL "+e+".",{link:t,regex:y[i]});return false}}return true}function h(){let e=navigator.connection;if(!e){return false}if(e.saveData){c.logOther("Data Saving Mode detected.");return true}return false}function d(){if(R!==null){return R}R=h();return R}if(!window.requestIdleCallback){window.requestIdleCallback=function(e,t){var t=t||{};var n=1;var r=t.timeout||n;var o=performance.now();return setTimeout(function(){e({get didTimeout(){return t.timeout?false:performance.now()-o-n>r},timeRemaining:function(){return Math.max(0,n+(performance.now()-o))}})},n)}}if(!window.cancelIdleCallback){window.cancelIdleCallback=function(e){clearTimeout(e)}}let p=function(e,t){c.logLcpEvent("MUTATION_DETECTED",e);clearTimeout(D);D=setTimeout(P,500,e)};let g=function(e,t="",n=false){if(O.indexOf(e)>-1){c.logOther("Prefetch skipped: URL is already prefetched.",e);return}if(O.length>15){c.logOther("Prefetch skipped: Maximum prefetches threshold reached.");return}if(!n&&!a()){c.logOther("Prefetch skipped: on cooldown",e);return}if(d()){c.logOther("Prefetch skipped: limited connection",e);return}const r=document.createElement("link");r.rel="prefetch";r.type="text/html";r.href=e;document.head.appendChild(r);O.push(e);o=performance.now();c.logPrefetch(e,t);return true};function m(t){let e=document.querySelector("body");while(t!=e){if(L(t)){t=t.parentElement;c.logOther("Skipping LCP container level: Inside a <nav> element.",t);continue}let e=Array.from(t.querySelectorAll("a"));c.logOther("filtering links...",e);e=e.filter(e=>{if(L(e)){c.logOther("Skipping link: Inside a <nav> element.",t);return false}return s(e)});if(e.length>0)return[e,t];t=t.parentElement}return[[],null]}function L(e){return e.closest("nav")!==null||e.nodeName=="NAV"}function w(e){N=true;if(I&&!S){v()}}function E(e){I=true;if(N&&!S){if(v()){window.cancelIdleCallback(b)}else{C++;if(C>2){window.cancelIdleCallback(b);c.logLcpEvent("IDLE_CALLBACK_CANCELLED")}}}}function v(){if(_==null){c.logLcpEvent("doLcpPrefetching_CALLBACK_CALLED_WITHOUT_LCP_ELEMENT");return false}let e=[];[e,T]=m(_);if(e.length==0){c.logLcpEvent("NO_LINKS_FOUND");return false}if(e.length>0){g(e[0].href,"LCP",!S);S=true}A.observe(T,{subtree:true,childList:true,attributes:true});c.logLcpEvent("MUTATION_OBSERVER_REGISTERED");window.cancelIdleCallback(b);c.logLcpEvent("IDLE_CALLBACK_CANCELLED")}function P(e){c.logLcpEvent("MUTATION_RESCAN_TRIGGERED",e);let t=m(T)[0];if(t.length>0){g(t[0].href,"LCP_MUTATION")}}let O=[];let _=null;let T=null;let b=0;let C=0;let k=["mousemove","click","keydown","touchmove","touchstart"];let N=false;let I=false;const A=new MutationObserver(p);let D=0;let S=false;let R=null;let y=JSON.parse(atob("WyIuKj9cXD9hZGRcXC10b1xcLWNhcnRcXD0uKj8iLCIuKj8mYWRkXFwtdG9cXC1jYXJ0XFw9Lio/IiwiLio/ZG93bmxvYWQuKj8iLCIuKj9cXC5leGUiLCIuKj9cXC56aXAiLCIuKj9cXC5yYXIiLCIuKj9cXC5kZWIiLCIuKj9cXC5ycG0iLCIuKj9cXC5wa2ciLCIuKj9cXC5kbWciLCIuKj9cXC5wZGYiLCIuKj9cXC5tc2kiLCIuKj9cXC5tcDMiLCIuKj9cXC5kb2MiLCIuKj9cXC5kb2N4IiwiLio/XFwucHB0IiwiLio/XFwueGxzIiwiLio/XFwueGxzeCIsIi4qP1xcLm9kdCIsIi4qP1xcLnR4dCJd"));if(Object.prototype.toString.call(y)==="[object Object]"){c.logOther("EXCLUDES_AS_OBJECT",y);let e=[];for(const i in y){e.push(y[i])}y=e}y=y.map(e=>new RegExp(e));if(navigator.connection){navigator.connection.onchange=function(e,t){R=null;c.logOther("Connection changed",{effectiveType:navigator.connection.effectiveType,rtt:navigator.connection.rtt,downlink:navigator.connection.downlink,saveData:navigator.connection.saveData})}}f();u()})();</script><script nitro-exclude>(function() {!function(e,t){"object"==typeof exports&&"undefined"!=typeof module?t(exports):"function"==typeof define&&define.amd?define(["exports"],t):t((e="undefined"!=typeof globalThis?globalThis:e||self).webVitals={})}(this,(function(e){"use strict";var t,n,i,r,a=function(e,t){return{name:e,value:void 0===t?-1:t,delta:0,entries:[],id:"v2-".concat(Date.now(),"-").concat(Math.floor(8999999999999*Math.random())+1e12)}},o=function(e,t){try{if(PerformanceObserver.supportedEntryTypes.includes(e)){if("first-input"===e&&!("PerformanceEventTiming"in self))return;var n=new PerformanceObserver((function(e){return e.getEntries().map(t)}));return n.observe({type:e,buffered:!0}),n}}catch(e){}},u=function(e,t){var n=function n(i){"pagehide"!==i.type&&"hidden"!==document.visibilityState||(e(i),t&&(removeEventListener("visibilitychange",n,!0),removeEventListener("pagehide",n,!0)))};addEventListener("visibilitychange",n,!0),addEventListener("pagehide",n,!0)},c=function(e){addEventListener("pageshow",(function(t){t.persisted&&e(t)}),!0)},f=function(e,t,n){var i;return function(r){t.value>=0&&(r||n)&&(t.delta=t.value-(i||0),(t.delta||void 0===i)&&(i=t.value,e(t)))}},s=-1,m=function(){return"hidden"===document.visibilityState?0:1/0},d=function(){u((function(e){var t=e.timeStamp;s=t}),!0)},v=function(){return s<0&&(s=m(),d(),c((function(){setTimeout((function(){s=m(),d()}),0)}))),{get firstHiddenTime(){return s}}},p=function(e,t){var n,i=v(),r=a("FCP"),u=function(e){"first-contentful-paint"===e.name&&(m&&m.disconnect(),e.startTime<i.firstHiddenTime&&(r.value=e.startTime,r.entries.push(e),n(!0)))},s=window.performance&&performance.getEntriesByName&&performance.getEntriesByName("first-contentful-paint")[0],m=s?null:o("paint",u);(s||m)&&(n=f(e,r,t),s&&u(s),c((function(i){r=a("FCP"),n=f(e,r,t),requestAnimationFrame((function(){requestAnimationFrame((function(){r.value=performance.now()-i.timeStamp,n(!0)}))}))})))},l=!1,g=-1,y={passive:!0,capture:!0},T=new Date,h=function(e,r){t||(t=r,n=e,i=new Date,S(removeEventListener),E())},E=function(){if(n>=0&&n<i-T){var e={entryType:"first-input",name:t.type,target:t.target,cancelable:t.cancelable,startTime:t.timeStamp,processingStart:t.timeStamp+n};r.forEach((function(t){t(e)})),r=[]}},L=function(e){if(e.cancelable){var t=(e.timeStamp>1e12?new Date:performance.now())-e.timeStamp;"pointerdown"==e.type?function(e,t){var n=function(){h(e,t),r()},i=function(){r()},r=function(){removeEventListener("pointerup",n,y),removeEventListener("pointercancel",i,y)};addEventListener("pointerup",n,y),addEventListener("pointercancel",i,y)}(t,e):h(t,e)}},S=function(e){["mousedown","keydown","touchstart","pointerdown"].forEach((function(t){return e(t,L,y)}))},w={};e.getCLS=function(e,t){l||(p((function(e){g=e.value})),l=!0);var n,i=function(t){g>-1&&e(t)},r=a("CLS",0),s=0,m=[],d=function(e){if(!e.hadRecentInput){var t=m[0],i=m[m.length-1];s&&e.startTime-i.startTime<1e3&&e.startTime-t.startTime<5e3?(s+=e.value,m.push(e)):(s=e.value,m=[e]),s>r.value&&(r.value=s,r.entries=m,n())}},v=o("layout-shift",d);v&&(n=f(i,r,t),u((function(){v.takeRecords().map(d),n(!0)})),c((function(){s=0,g=-1,r=a("CLS",0),n=f(i,r,t)})))},e.getFCP=p,e.getFID=function(e,i){var s,m=v(),d=a("FID"),p=function(e){e.startTime<m.firstHiddenTime&&(d.value=e.processingStart-e.startTime,d.entries.push(e),s(!0))},l=o("first-input",p);s=f(e,d,i),l&&u((function(){l.takeRecords().map(p),l.disconnect()}),!0),l&&c((function(){var o;d=a("FID"),s=f(e,d,i),r=[],n=-1,t=null,S(addEventListener),o=p,r.push(o),E()}))},e.getLCP=function(e,t){var n,i=v(),r=a("LCP"),s=function(e){var t=e.startTime;t<i.firstHiddenTime&&(r.value=t,r.entries.push(e),n())},m=o("largest-contentful-paint",s);if(m){n=f(e,r,t);var d=function(){w[r.id]||(m.takeRecords().map(s),m.disconnect(),w[r.id]=!0,n(!0))};["keydown","click"].forEach((function(e){addEventListener(e,d,{once:!0,capture:!0})})),u(d,!0),c((function(i){r=a("LCP"),n=f(e,r,t),requestAnimationFrame((function(){requestAnimationFrame((function(){r.value=performance.now()-i.timeStamp,w[r.id]=!0,n(!0)}))}))}))}},e.getTTFB=function(e){var t,n=a("TTFB");t=function(){try{var t=performance.getEntriesByType("navigation")[0]||function(){var e=performance.timing,t={entryType:"navigation",startTime:0};for(var n in e)"navigationStart"!==n&&"toJSON"!==n&&(t[n]=Math.max(e[n]-e.navigationStart,0));return t}();if(n.value=n.delta=t.responseStart,n.value<0||n.value>performance.now())return;n.entries=[t],e(n)}catch(e){}},"complete"===document.readyState?setTimeout(t,0):addEventListener("load",(function(){return setTimeout(t,0)}))},Object.defineProperty(e,"__esModule",{value:!0})}));
var nitroTelemetry=function(){let e=!!window.IS_NITROPACK;let c=performance.getEntriesByType("navigation")[0];let d=c.responseStart-c.requestStart<=5;let t=true;let o=false;let n=null;let l=null;let w=null;let r=h();let p="https://to.getnitropack.com/";let g="odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI";let y=typeof NPRL!="undefined";let S=y?"loadNitro":"load";let a;let i;let f;let v=["missReason","pageType"];function h(){return"NPTelemetry:"+btoa(Date.now())+"_"+b()+(e?"_o":"_u")+(d?"_pre":"_dow")}function m(){return document.visibilityState==="visible"}function N(){t=true;r=h();a=null;i={crux:null};I()}function I(){f={sessionEntry:null,unknown:0,afterStyles:0,afterPageLoad:0,afterScroll:0,total:0}}function L(){let n=performance.getEntriesByType("navigation");let l={};for(let t in n){let e=n[t];l.ttfb=e.responseStart-e.requestStart}return l}function b(){if(navigator.connection){return navigator.connection.effectiveType}else{return"u"}}function P(){let e=r+":pageview";u(e,{pv:1})}function D(){if(typeof NPTelemetryMetadata==="object"){for(let e in NPTelemetryMetadata){if(v.indexOf(e)===-1){delete NPTelemetryMetadata[e]}}let e=r+":metadata";u(e,{metaData:NPTelemetryMetadata})}}function E(){if(window.localStorage){let e="NPTelemetryMeta:lastpv";let t=parseInt(localStorage.getItem(e));let n=Date.now();localStorage.setItem(e,n);return isNaN(t)||t===0?-1:(n-t)/1e3}return null}function u(e,t){t.url=window.location.href.replace(window.location.hash,"");if(window.localStorage){localStorage.setItem(e,JSON.stringify(t))}else{O([t])}}function s(e){if(!window.localStorage)return;let n=null;let l={};let t=0;let r;let a;let i;do{n=localStorage.key(t);if(n&&n.indexOf("NPTelemetry:")===0){i=n.split(":")[1];r=JSON.parse(localStorage.getItem(n));if(!l[i])l[i]={};let t=l[i];for(let e in r){a=r[e];if(a!==null){if(e=="url"||e==="metaData"||e==="prefetchInitiator"){t[e]=a}else if(T(a)){if(!t[e])t[e]=0;t[e]+=a}else if(k(a)){if(!t[e])t[e]={};if(!t[e][a])t[e][a]=0;t[e][a]++}}}localStorage.removeItem(n)}else{t++}}while(n!==null);if(Object.keys(l).length){O(l)}o=false}function T(e){return!isNaN(parseFloat(e))&&isFinite(e)}function k(e){return typeof e==="string"||e instanceof String}function O(e){let t=new FormData;t.append("key",g);if(Object.keys(e).length){t.append("props",JSON.stringify(e));navigator.sendBeacon&&navigator.sendBeacon(p,t)||fetch(p,{body:t,method:"POST",keepalive:true})}}function M(e){if(e===s){if(o){return}else{o=true}}if(window.requestIdleCallback){requestIdleCallback(e,{timeout:1e3})}else{setTimeout(e,1e3)}}function _(){let e=r+":cwv";let t={};if(i.crux){t["lcp:crux"]=Math.round(i.crux)}if(f.total!==null){let e=1e3;t["cls:total"]=Math.round(f.total*e);if(f.afterStyles){t["cls:afterStylesDelta"]=Math.round(f.afterStyles*e)}if(f.afterPageLoad){t["cls:afterPageLoadDelta"]=Math.round(f.afterPageLoad*e)}if(f.afterScroll){t["cls:afterScrollDelta"]=Math.round(f.afterScroll*e)}if(f.unknown){t["cls:unknownDelta"]=Math.round(f.unknown*e)}}else{t["cls:total"]=0}if(a){t["fid"]=Math.round(a)}if(Object.keys(t).length){u(e,t)}}function x(){n=Date.now();window.removeEventListener("NitroStylesLoaded",x,true)}function C(){l=Date.now();window.removeEventListener(S,C,true)}function j(){w=Date.now()}function q(e){return n&&Date.now()-n<e}function B(e){return l&&Date.now()-l<e}function F(e){return w&&Date.now()-w<e}function J(){let t=JSON.parse(window.sessionStorage.getItem("nitro_prefetched_urls"));if(t!==null){window.sessionStorage.removeItem("nitro_prefetched_urls");let e=window.location.href;if(t[e]){prefetchInitiator=t[e]}else if(d){prefetchInitiator="UNKNOWN"}else{prefetchInitiator="NONE"}u(r+":pagePrefetches",{prefetchCount:Object.entries(t).length,prefetchInitiator:prefetchInitiator})}}N();window.addEventListener(S,C,true);document.addEventListener("scroll",j,{capture:true,passive:true});if(y){window.addEventListener("NitroStylesLoaded",x,true)}window.addEventListener("load",function(){let e=L();let t=E();D();J();u(r+":net",{ttfb:Math.round(e.ttfb),lastNavDiff:t})},true);window.addEventListener("pageshow",function(e){if(m()&&(t||e.persisted)){P();M(s);t=false}},true);window.addEventListener("pagehide",function(e){_();N();s()},true);document.addEventListener("visibilitychange",function(e){if(m()){if(t){P();M(s);t=false}}else{}},true);webVitals.getLCP(function(e){i.crux=e.value},true);webVitals.getCLS(function(e){if(e.entries[0]!==f.sessionEntry){I();f.sessionEntry=e.entries[0]}f.total=e.value;let t=250;let n=F(t)+B(t)+q(t);if(n==1){if(F(t)){f.afterScroll+=e.delta}if(B(t)){f.afterPageLoad+=e.delta}if(q(t)){f.afterStyles+=e.delta}}else{f.unknown+=e.delta}},true);webVitals.getFID(function(e){a=e.value});return{}}();;})();</script></head> <body class="home page-template-default page page-id-319 custom-background preloader blog_mode_home body_tag body_style_wide scheme_default  is_stream blog_style_excerpt sidebar_hide expand_content remove_margins header_style_header-default header_position_default header_title_off menu_style_top no_layout wpb-js-composer js-comp-ver-5.6 vc_responsive"> <noscript><iframe src="https://www.googletagmanager.com/ns.html?id=GTM-5DFNXDW" height="0" width="0" style="display:none;visibility:hidden"></iframe></noscript> <div class="body_wrap"> <div class="page_wrap"> <header class="top_panel top_panel_default scheme_default"> <div class="top_panel_top			scheme_default"> <div class="top_panel_top_wrap clearfix"> <div class="content_wrap"> <div class="open_hours">Email : <a href="mailto:contact@chirurgies-esthetique-entunisie.com">contact@chirurgies-esthetique-entunisie.com</a></div> <div class="info_phone"> <span class="info_phone_number"></span> </div> </div> </div> </div> <div class="top_panel_fixed_wrap"></div> <div class="top_panel_navi 						scheme_default"> <div class="menu_main_wrap clearfix menu_hover_fade"> <div class="content_wrap"> <a class="logo" href="#"><img alt="" width="159" height="91" nitro-lazy-src="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/04/logo-chirurgie-2.png" class="logo_main nitro-lazy" nitro-lazy-empty id="Mjc0OjE4MQ==-1" src="data:image/svg+xml;nitro-empty-id=Mjc0OjE4MQ==-1;base64,PHN2ZyB2aWV3Qm94PSIwIDAgMTU5IDkxIiB3aWR0aD0iMTU5IiBoZWlnaHQ9IjkxIiB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciPjwvc3ZnPg==" /></a><nav class="menu_main_nav_area"><ul id="menu_main" class="menu_main_nav"><li id="menu-item-4326" class="menu-item menu-item-type-custom menu-item-object-custom menu-item-has-children menu-item-4326"><a href="#"><span>Interventions</span></a> <ul class="sub-menu"><li id="menu-item-4318" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-has-children menu-item-4318"><a href="https://www.chirurgies-esthetique-entunisie.com/chirurgie-du-visage-tunisie/"><span>Chirurgie du visage</span></a> <ul class="sub-menu"><li id="menu-item-4321" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4321"><a href="https://www.chirurgies-esthetique-entunisie.com/lifting-cervico-facial-tunisie/"><span>Lifting Cervico Facial</span></a></li><li id="menu-item-4322" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4322"><a href="https://www.chirurgies-esthetique-entunisie.com/lipofilling-visage-tunisie/"><span>Lipofilling du visage</span></a></li><li id="menu-item-4319" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4319"><a href="https://www.chirurgies-esthetique-entunisie.com/blepharoplastie-tunisie/"><span>Blépharoplastie</span></a></li><li id="menu-item-4320" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4320"><a href="https://www.chirurgies-esthetique-entunisie.com/boule-de-bichat-tunisie/"><span>Boule de bichat</span></a></li><li id="menu-item-4323" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4323"><a href="https://www.chirurgies-esthetique-entunisie.com/rhinoplastie-tunisie/"><span>Rhinoplastie</span></a></li><li id="menu-item-4324" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4324"><a href="https://www.chirurgies-esthetique-entunisie.com/genioplastie-tunisie/"><span>Génioplastie</span></a></li><li id="menu-item-4335" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4335"><a href="https://www.chirurgies-esthetique-entunisie.com/otoplastie-tunisie/"><span>Otoplastie</span></a></li></ul> </li><li id="menu-item-4399" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-has-children menu-item-4399"><a href="https://www.chirurgies-esthetique-entunisie.com/chirurgie-mammaire-tunisie/"><span>Chirurgie mammaire</span></a> <ul class="sub-menu"><li id="menu-item-4403" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4403"><a href="https://www.chirurgies-esthetique-entunisie.com/augmentation-mammaire-tunisie/"><span>Augmentation mammaire</span></a></li><li id="menu-item-4400" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4400"><a href="https://www.chirurgies-esthetique-entunisie.com/reduction-mammaire-tunisie/"><span>Réduction mammaire</span></a></li><li id="menu-item-4402" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4402"><a href="https://www.chirurgies-esthetique-entunisie.com/lipofilling-mammaire-tunisie/"><span>Lipofilling mammaire</span></a></li><li id="menu-item-4401" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4401"><a href="https://www.chirurgies-esthetique-entunisie.com/lifting-mammaire-tunisie/"><span>Lifting mammaire</span></a></li><li id="menu-item-4398" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4398"><a href="https://www.chirurgies-esthetique-entunisie.com/gynecomastie-homme-tunisie/"><span>Gynécomastie</span></a></li></ul> </li><li id="menu-item-4519" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-has-children menu-item-4519"><a href="https://www.chirurgies-esthetique-entunisie.com/chirurgie-esthetique-corps-tunisie/"><span>Chirurgie esthétique corps</span></a> <ul class="sub-menu"><li id="menu-item-4525" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4525"><a href="https://www.chirurgies-esthetique-entunisie.com/liposuccion-complete-tunisie/"><span>Liposuccion complète</span></a></li><li id="menu-item-4522" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4522"><a href="https://www.chirurgies-esthetique-entunisie.com/liposuccion-ventre-tunisie/"><span>Liposuccion ventre</span></a></li><li id="menu-item-4524" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4524"><a href="https://www.chirurgies-esthetique-entunisie.com/brazilian-butt-lift-prix/"><span>Brazilian Butt Lift</span></a></li><li id="menu-item-4539" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4539"><a href="https://www.chirurgies-esthetique-entunisie.com/lipofilling-fessier-tunisie/"><span>Lipofilling fessier</span></a></li><li id="menu-item-5046" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-5046"><a href="https://www.chirurgies-esthetique-entunisie.com/implant-fessier-tunisie/"><span>Implant fessier</span></a></li><li id="menu-item-4521" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4521"><a href="https://www.chirurgies-esthetique-entunisie.com/abdominoplastie-tunisie/"><span>Abdominoplastie</span></a></li><li id="menu-item-5090" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-5090"><a href="https://www.chirurgies-esthetique-entunisie.com/abdominal-etching-tunisie/"><span>Abdominal etching</span></a></li><li id="menu-item-4523" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4523"><a href="https://www.chirurgies-esthetique-entunisie.com/body-lift-tunisie/"><span>Body Lift</span></a></li><li id="menu-item-4520" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4520"><a href="https://www.chirurgies-esthetique-entunisie.com/lipolyse-tunisie/"><span>Lipolyse</span></a></li></ul> </li><li id="menu-item-4601" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-has-children menu-item-4601"><a href="https://www.chirurgies-esthetique-entunisie.com/chirurgie-bariatrique-tunisie/"><span>Chirurgie bariatrique</span></a> <ul class="sub-menu"><li id="menu-item-4603" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4603"><a href="https://www.chirurgies-esthetique-entunisie.com/sleeve-gastrique-tunisie/"><span>Sleeve Gastrique</span></a></li><li id="menu-item-4600" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4600"><a href="https://www.chirurgies-esthetique-entunisie.com/by-pass-gastrique-tunisie/"><span>By Pass Gastrique</span></a></li><li id="menu-item-4602" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4602"><a href="https://www.chirurgies-esthetique-entunisie.com/ballon-gastrique-tunisie/"><span>Ballon Gastrique</span></a></li><li id="menu-item-4599" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4599"><a href="https://www.chirurgies-esthetique-entunisie.com/anneau-gastrique-tunisie/"><span>Anneau Gastrique</span></a></li></ul> </li><li id="menu-item-4645" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-has-children menu-item-4645"><a href="https://www.chirurgies-esthetique-entunisie.com/chirurgie-esthetique-dentaire/"><span>Chirurgie esthétique dentaire</span></a> <ul class="sub-menu"><li id="menu-item-4646" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4646"><a href="https://www.chirurgies-esthetique-entunisie.com/couronne-dentaire-tunisie/"><span>Couronne dentaire</span></a></li><li id="menu-item-4680" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4680"><a href="https://www.chirurgies-esthetique-entunisie.com/facette-dentaire-tunisie/"><span>Facette dentaire</span></a></li><li id="menu-item-4648" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4648"><a href="https://www.chirurgies-esthetique-entunisie.com/implant-dentaire-tunisie/"><span>Implant dentaire</span></a></li><li id="menu-item-4647" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4647"><a href="https://www.chirurgies-esthetique-entunisie.com/white-smile/"><span>White Smile</span></a></li></ul> </li><li id="menu-item-4705" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4705"><a href="https://www.chirurgies-esthetique-entunisie.com/greffe-de-cheveux-tunisie/"><span>Greffe de cheveux</span></a></li></ul> </li><li id="menu-item-4889" class="menu-item menu-item-type-custom menu-item-object-custom menu-item-4889"><a href="https://www.chirurgies-esthetique-entunisie.com/chirurgie-esthetique-avant-apres/"><span>Avant Après</span></a></li><li id="menu-item-3949" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-3949"><a href="https://www.chirurgies-esthetique-entunisie.com/contact/"><span>CONTACT</span></a></li><li id="menu-item-856" class="menu_item_button menu-item menu-item-type-post_type menu-item-object-page menu-item-856"><a href="https://www.chirurgies-esthetique-entunisie.com/devis/"><span>Demande de devis</span></a></li></ul></nav><a class="menu_mobile_button icon-menu-2"></a> </div> </div> </div> <div class="header_widgets_wrap widget_area header_fullwidth"> <div class="header_widgets_wrap_inner widget_area_inner"> <aside id="custom_html-2" class="widget_text widget widget_custom_html"><div class="textwidget custom-html-widget"></div></aside> </div> </div> </header><div class="menu_mobile_overlay"></div> <div class="menu_mobile scheme_dark"> <div class="menu_mobile_inner"> <a class="menu_mobile_close icon-cancel"></a><a class="logo" href="#"><img alt="" width="159" height="91" nitro-lazy-src="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/04/logo-chirurgie-2.png" class="logo_main nitro-lazy" nitro-lazy-empty id="Mjk1OjIyNg==-1" src="data:image/svg+xml;nitro-empty-id=Mjk1OjIyNg==-1;base64,PHN2ZyB2aWV3Qm94PSIwIDAgMTU5IDkxIiB3aWR0aD0iMTU5IiBoZWlnaHQ9IjkxIiB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciPjwvc3ZnPg==" /></a><nav class="menu_mobile_nav_area"><ul id="menu_mobile" class="menu_mobile_nav"><li id="menu_mobile-item-4326" class="menu-item menu-item-type-custom menu-item-object-custom menu-item-has-children menu-item-4326"><a href="#"><span>Interventions</span></a> <ul class="sub-menu"><li id="menu_mobile-item-4318" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-has-children menu-item-4318"><a href="https://www.chirurgies-esthetique-entunisie.com/chirurgie-du-visage-tunisie/"><span>Chirurgie du visage</span></a> <ul class="sub-menu"><li id="menu_mobile-item-4321" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4321"><a href="https://www.chirurgies-esthetique-entunisie.com/lifting-cervico-facial-tunisie/"><span>Lifting Cervico Facial</span></a></li><li id="menu_mobile-item-4322" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4322"><a href="https://www.chirurgies-esthetique-entunisie.com/lipofilling-visage-tunisie/"><span>Lipofilling du visage</span></a></li><li id="menu_mobile-item-4319" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4319"><a href="https://www.chirurgies-esthetique-entunisie.com/blepharoplastie-tunisie/"><span>Blépharoplastie</span></a></li><li id="menu_mobile-item-4320" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4320"><a href="https://www.chirurgies-esthetique-entunisie.com/boule-de-bichat-tunisie/"><span>Boule de bichat</span></a></li><li id="menu_mobile-item-4323" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4323"><a href="https://www.chirurgies-esthetique-entunisie.com/rhinoplastie-tunisie/"><span>Rhinoplastie</span></a></li><li id="menu_mobile-item-4324" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4324"><a href="https://www.chirurgies-esthetique-entunisie.com/genioplastie-tunisie/"><span>Génioplastie</span></a></li><li id="menu_mobile-item-4335" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4335"><a href="https://www.chirurgies-esthetique-entunisie.com/otoplastie-tunisie/"><span>Otoplastie</span></a></li></ul> </li><li id="menu_mobile-item-4399" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-has-children menu-item-4399"><a href="https://www.chirurgies-esthetique-entunisie.com/chirurgie-mammaire-tunisie/"><span>Chirurgie mammaire</span></a> <ul class="sub-menu"><li id="menu_mobile-item-4403" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4403"><a href="https://www.chirurgies-esthetique-entunisie.com/augmentation-mammaire-tunisie/"><span>Augmentation mammaire</span></a></li><li id="menu_mobile-item-4400" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4400"><a href="https://www.chirurgies-esthetique-entunisie.com/reduction-mammaire-tunisie/"><span>Réduction mammaire</span></a></li><li id="menu_mobile-item-4402" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4402"><a href="https://www.chirurgies-esthetique-entunisie.com/lipofilling-mammaire-tunisie/"><span>Lipofilling mammaire</span></a></li><li id="menu_mobile-item-4401" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4401"><a href="https://www.chirurgies-esthetique-entunisie.com/lifting-mammaire-tunisie/"><span>Lifting mammaire</span></a></li><li id="menu_mobile-item-4398" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4398"><a href="https://www.chirurgies-esthetique-entunisie.com/gynecomastie-homme-tunisie/"><span>Gynécomastie</span></a></li></ul> </li><li id="menu_mobile-item-4519" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-has-children menu-item-4519"><a href="https://www.chirurgies-esthetique-entunisie.com/chirurgie-esthetique-corps-tunisie/"><span>Chirurgie esthétique corps</span></a> <ul class="sub-menu"><li id="menu_mobile-item-4525" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4525"><a href="https://www.chirurgies-esthetique-entunisie.com/liposuccion-complete-tunisie/"><span>Liposuccion complète</span></a></li><li id="menu_mobile-item-4522" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4522"><a href="https://www.chirurgies-esthetique-entunisie.com/liposuccion-ventre-tunisie/"><span>Liposuccion ventre</span></a></li><li id="menu_mobile-item-4524" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4524"><a href="https://www.chirurgies-esthetique-entunisie.com/brazilian-butt-lift-prix/"><span>Brazilian Butt Lift</span></a></li><li id="menu_mobile-item-4539" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4539"><a href="https://www.chirurgies-esthetique-entunisie.com/lipofilling-fessier-tunisie/"><span>Lipofilling fessier</span></a></li><li id="menu_mobile-item-5046" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-5046"><a href="https://www.chirurgies-esthetique-entunisie.com/implant-fessier-tunisie/"><span>Implant fessier</span></a></li><li id="menu_mobile-item-4521" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4521"><a href="https://www.chirurgies-esthetique-entunisie.com/abdominoplastie-tunisie/"><span>Abdominoplastie</span></a></li><li id="menu_mobile-item-5090" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-5090"><a href="https://www.chirurgies-esthetique-entunisie.com/abdominal-etching-tunisie/"><span>Abdominal etching</span></a></li><li id="menu_mobile-item-4523" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4523"><a href="https://www.chirurgies-esthetique-entunisie.com/body-lift-tunisie/"><span>Body Lift</span></a></li><li id="menu_mobile-item-4520" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4520"><a href="https://www.chirurgies-esthetique-entunisie.com/lipolyse-tunisie/"><span>Lipolyse</span></a></li></ul> </li><li id="menu_mobile-item-4601" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-has-children menu-item-4601"><a href="https://www.chirurgies-esthetique-entunisie.com/chirurgie-bariatrique-tunisie/"><span>Chirurgie bariatrique</span></a> <ul class="sub-menu"><li id="menu_mobile-item-4603" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4603"><a href="https://www.chirurgies-esthetique-entunisie.com/sleeve-gastrique-tunisie/"><span>Sleeve Gastrique</span></a></li><li id="menu_mobile-item-4600" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4600"><a href="https://www.chirurgies-esthetique-entunisie.com/by-pass-gastrique-tunisie/"><span>By Pass Gastrique</span></a></li><li id="menu_mobile-item-4602" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4602"><a href="https://www.chirurgies-esthetique-entunisie.com/ballon-gastrique-tunisie/"><span>Ballon Gastrique</span></a></li><li id="menu_mobile-item-4599" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4599"><a href="https://www.chirurgies-esthetique-entunisie.com/anneau-gastrique-tunisie/"><span>Anneau Gastrique</span></a></li></ul> </li><li id="menu_mobile-item-4645" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-has-children menu-item-4645"><a href="https://www.chirurgies-esthetique-entunisie.com/chirurgie-esthetique-dentaire/"><span>Chirurgie esthétique dentaire</span></a> <ul class="sub-menu"><li id="menu_mobile-item-4646" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4646"><a href="https://www.chirurgies-esthetique-entunisie.com/couronne-dentaire-tunisie/"><span>Couronne dentaire</span></a></li><li id="menu_mobile-item-4680" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4680"><a href="https://www.chirurgies-esthetique-entunisie.com/facette-dentaire-tunisie/"><span>Facette dentaire</span></a></li><li id="menu_mobile-item-4648" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4648"><a href="https://www.chirurgies-esthetique-entunisie.com/implant-dentaire-tunisie/"><span>Implant dentaire</span></a></li><li id="menu_mobile-item-4647" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4647"><a href="https://www.chirurgies-esthetique-entunisie.com/white-smile/"><span>White Smile</span></a></li></ul> </li><li id="menu_mobile-item-4705" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-4705"><a href="https://www.chirurgies-esthetique-entunisie.com/greffe-de-cheveux-tunisie/"><span>Greffe de cheveux</span></a></li></ul> </li><li id="menu_mobile-item-4889" class="menu-item menu-item-type-custom menu-item-object-custom menu-item-4889"><a href="https://www.chirurgies-esthetique-entunisie.com/chirurgie-esthetique-avant-apres/"><span>Avant Après</span></a></li><li id="menu_mobile-item-3949" class="menu-item menu-item-type-post_type menu-item-object-page menu-item-3949"><a href="https://www.chirurgies-esthetique-entunisie.com/contact/"><span>CONTACT</span></a></li><li id="menu_mobile-item-856" class="menu_item_button menu-item menu-item-type-post_type menu-item-object-page menu-item-856"><a href="https://www.chirurgies-esthetique-entunisie.com/devis/"><span>Demande de devis</span></a></li></ul></nav> </div> </div> <div class="page_content_wrap scheme_default"> <div class="content_wrap"> <div class="content"> <article id="post-319" class="post_item_single post_type_page post-319 page type-page status-publish hentry"> <div class="post_content entry-content"> <div data-vc-full-width="true" data-vc-full-width-init="false" data-vc-stretch-content="true" class="vc_row wpb_row vc_row-fluid vc_custom_1520503636019 vc_row-has-fill vc_row-no-padding"><div class="wpb_column vc_column_container vc_col-sm-12"><div class="vc_column-inner"><div class="wpb_wrapper"> <div class="wpb_text_column wpb_content_element"> <div class="wpb_wrapper"> <p><img alt="la chirugie esthetique en Tunisie" width="1024" height="452" sizes="(max-width: 1024px) 100vw, 1024px" nitro-lazy-srcset="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/06/290292777_5089201531134059_2674232276719326447_n-1024x452.jpg 1024w, https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/06/290292777_5089201531134059_2674232276719326447_n-300x132.jpg 300w, https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/06/290292777_5089201531134059_2674232276719326447_n-768x339.jpg 768w, https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/06/290292777_5089201531134059_2674232276719326447_n-1536x677.jpg 1536w, https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/06/290292777_5089201531134059_2674232276719326447_n-370x163.jpg 370w, https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/06/290292777_5089201531134059_2674232276719326447_n-770x340.jpg 770w, https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/06/290292777_5089201531134059_2674232276719326447_n.jpg 1651w" nitro-lazy-src="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/06/290292777_5089201531134059_2674232276719326447_n-1024x452.jpg" class="aligncenter wp-image-4949 size-large nitro-lazy" nitro-lazy-empty id="MzE3OjEzMDU=-1" src="data:image/svg+xml;nitro-empty-id=MzE3OjEzMDU=-1;base64,PHN2ZyB2aWV3Qm94PSIwIDAgMTAyNCA0NTIiIHdpZHRoPSIxMDI0IiBoZWlnaHQ9IjQ1MiIgeG1sbnM9Imh0dHA6Ly93d3cudzMub3JnLzIwMDAvc3ZnIj48L3N2Zz4=" /></p> </div> </div> </div></div></div></div><div class="vc_row-full-width vc_clearfix"></div><div data-vc-full-width="true" data-vc-full-width-init="false" class="vc_row wpb_row vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-12"><div class="vc_column-inner"><div class="wpb_wrapper"> <div class="wpb_text_column wpb_content_element"> <div class="wpb_wrapper"> <h1 style="font-size:2em;color:#35769e;text-align:center;">Chirurgie Esthétique Tunisie : La meilleure agence du tourisme médical</h1> </div> </div> <div class="wpb_text_column wpb_content_element"> <div class="wpb_wrapper"> <h2 style="text-align:center;font-size:1.2em;">Chirurgie plastique en Tunisie,<br /> la re-<span style="color:#1d1d1d;">sculpture</span> esthetique du corps parfait !</h2> <p style="font-size:1.2em;">Pour la chirurgie esthétique de vos rêves, <strong>Chirurgie esthetique Tunisie</strong> est l&rsquo;agence qu&rsquo;il vous faut !<br /> Pour commencer, il faut savoir que la <strong>chirurgie esthétique en Tunisie</strong> est un secteur en pleine expansion qui regroupe plusieurs spécialités chirurgicales. En plus, celle-ci est généralement associée à un séjour tout compris à prix pas chers à Tunis.</p> <p style="font-size:1.2em;">A des <strong>tarifs 60% moins cher qu&rsquo;en France</strong>, les cliniques spécialisées en chirurgie esthétique en Tunisie sont équipées d&rsquo;un matériel chirurgical de pointe.<br /> C’est ainsi qu’ils proposent des consultations en médecine esthétique et réparatrice. De plus, en Tunisie et avec l’assistance de notre agence, nous vous proposons :</p> <ul> <li style="text-align:justify;font-size:1.2em;">&#8211; Premièrement, un accueil à Tunis dans un cadre chaleureux et accueillant avec notre équipe d&rsquo;assistantes et de professionnels.</li> <li style="text-align:justify;font-size:1.2em;">&#8211; Deuxièmement, une clinique de chirurgie esthétique avec un équipement médical haut standing pour votre entière satisfaction.</li> </ul> <p style="font-size:1.2em;"><strong>Chirurgie Esthétique Tunisie</strong>, l&rsquo;<strong>agence</strong> spécialisée dans le <strong>tourisme médical</strong>, est ainsi dotée d’un savoir-faire et d’une expérience de plusieurs années.<br /> En effet, chirurgie esthétique Tunisie est la référence pour un séjour médical juste répondant à toutes vos attentes.</p> </div> </div> </div></div></div></div><div class="vc_row-full-width vc_clearfix"></div><div data-vc-full-width="true" data-vc-full-width-init="false" class="vc_row wpb_row vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-12"><div class="vc_column-inner"><div class="wpb_wrapper"> <div class="wpb_text_column wpb_content_element"> <div class="wpb_wrapper"> <h2 style="font-size:2em;color:#35769e;">Chirurgie Esthetique Tunisie, ce que nous proposons</h2> </div> </div> </div></div></div></div><div class="vc_row-full-width vc_clearfix"></div><div data-vc-full-width="true" data-vc-full-width-init="false" class="vc_row wpb_row vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-4"><div class="vc_column-inner"><div class="wpb_wrapper"> <div class="wpb_single_image wpb_content_element vc_align_center"> <figure class="wpb_wrapper vc_figure"> <div class="vc_single_image-wrapper   vc_box_border_grey"><img width="300" height="200" alt="chirurgie esthetique tunisie visage" nitro-lazy-src="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/04/chiruirgie-de-visage.jpg" class="vc_single_image-img attachment-medium nitro-lazy" nitro-lazy-empty id="MzUxOjI5OQ==-1" src="data:image/svg+xml;nitro-empty-id=MzUxOjI5OQ==-1;base64,PHN2ZyB2aWV3Qm94PSIwIDAgMzAwIDIwMCIgd2lkdGg9IjMwMCIgaGVpZ2h0PSIyMDAiIHhtbG5zPSJodHRwOi8vd3d3LnczLm9yZy8yMDAwL3N2ZyI+PC9zdmc+" /></div> </figure> </div> <h3 style="font-size:20px;text-align:center;font-family:Abril Fatface;font-weight:400;font-style:normal;" class="vc_custom_heading"><a href="https://www.chirurgies-esthetique-entunisie.com/chirurgie-du-visage-tunisie/" target=" _blank" title="chirurgie visage tunisie">Chirurgie Esthétique Du Visage</a></h3> <div class="wpb_text_column wpb_content_element  vc_custom_1658328834146"> <div class="wpb_wrapper"> <p style="text-align:justify;font-size:1.2em;">La chirurgie esthétique du visage permet d’éliminer les rides du visage pour un résultat naturel et discret pour une jeunesse éternelle ! Les différents types d&rsquo;<strong>opérations esthétiques du visage</strong> pratiquées en Tunisie sont : le lifting, lipofilling du visage, la rhinoplastie, la <a href="https://www.chirurgies-esthetique-entunisie.com/boule-de-bichat-tunisie/">réduction boule de bichat</a>&#8230;</p> </div> </div> </div></div></div><div class="wpb_column vc_column_container vc_col-sm-4"><div class="vc_column-inner"><div class="wpb_wrapper"> <div class="wpb_single_image wpb_content_element vc_align_center"> <figure class="wpb_wrapper vc_figure"> <div class="vc_single_image-wrapper   vc_box_border_grey"><img width="300" height="200" alt="chirurgie esthetique tunisie silhouette" nitro-lazy-src="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/04/chirurgie-de-la-silouhette.jpg" class="vc_single_image-img attachment-medium nitro-lazy" nitro-lazy-empty id="MzYzOjMwOQ==-1" src="data:image/svg+xml;nitro-empty-id=MzYzOjMwOQ==-1;base64,PHN2ZyB2aWV3Qm94PSIwIDAgMzAwIDIwMCIgd2lkdGg9IjMwMCIgaGVpZ2h0PSIyMDAiIHhtbG5zPSJodHRwOi8vd3d3LnczLm9yZy8yMDAwL3N2ZyI+PC9zdmc+" /></div> </figure> </div> <h3 style="font-size:20px;text-align:center;font-family:Abril Fatface;font-weight:400;font-style:normal;" class="vc_custom_heading">Chirurgie Esthétique de la silouhette</h3> <div class="wpb_text_column wpb_content_element"> <div class="wpb_wrapper"> <p style="text-align:justify;font-size:1.2em;">La <strong>chirurgie esthétique de la silhouette en Tunisie</strong>, a pour objectif de redonner au corps des proportions harmonieuses.&nbsp; En effet, elle corrige toutes les imperfections du corps : fesses, cuisses, ventre, bras et mollet. De plus, est toujours associée aux techniques de la liposuccion, le lipofilling et le lifting.</p> </div> </div> </div></div></div><div class="wpb_column vc_column_container vc_col-sm-4"><div class="vc_column-inner"><div class="wpb_wrapper"> <div class="wpb_single_image wpb_content_element vc_align_center"> <figure class="wpb_wrapper vc_figure"> <div class="vc_single_image-wrapper   vc_box_border_grey"><img width="300" height="200" alt="chirurgie esthetique Tunisie seins" nitro-lazy-src="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/04/chirurgie-esthetique-de-seins.jpg" class="vc_single_image-img attachment-medium nitro-lazy" nitro-lazy-empty id="Mzc1OjMwNw==-1" src="data:image/svg+xml;nitro-empty-id=Mzc1OjMwNw==-1;base64,PHN2ZyB2aWV3Qm94PSIwIDAgMzAwIDIwMCIgd2lkdGg9IjMwMCIgaGVpZ2h0PSIyMDAiIHhtbG5zPSJodHRwOi8vd3d3LnczLm9yZy8yMDAwL3N2ZyI+PC9zdmc+" /></div> </figure> </div> <h3 style="font-size:20px;text-align:center;font-family:Abril Fatface;font-weight:400;font-style:normal;" class="vc_custom_heading">chirurgie esthétique des seins</h3> <div class="wpb_text_column wpb_content_element  vc_custom_1657786695749"> <div class="wpb_wrapper"> <p style="text-align:justify;font-size:1.2em;">La <strong>chirurgie mammaire</strong> l&rsquo;intervention la plus demandée en Tunisie. Grâce à l&rsquo;augmentation, la réduction des seins, on peut obtenir des beaux seins fermes et naturels. Les interventions des seins inclus aussi la chirurgie esthétique avec implant ou lipofilling et la chirurgie reconstructrice comme le lifting des seins.</p> </div> </div> </div></div></div></div><div class="vc_row-full-width vc_clearfix"></div><div data-vc-full-width="true" data-vc-full-width-init="false" class="vc_row wpb_row vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-4"><div class="vc_column-inner vc_custom_1650894408947"><div class="wpb_wrapper"> <div class="wpb_single_image wpb_content_element vc_align_center"> <figure class="wpb_wrapper vc_figure"> <div class="vc_single_image-wrapper   vc_box_border_grey"><img width="300" height="200" alt="chirurgie esthetique Tunisie dentaire" nitro-lazy-src="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/04/chirurgie-esthetique-dentaire.jpg" class="vc_single_image-img attachment-medium nitro-lazy" nitro-lazy-empty id="Mzg3OjMxMA==-1" src="data:image/svg+xml;nitro-empty-id=Mzg3OjMxMA==-1;base64,PHN2ZyB2aWV3Qm94PSIwIDAgMzAwIDIwMCIgd2lkdGg9IjMwMCIgaGVpZ2h0PSIyMDAiIHhtbG5zPSJodHRwOi8vd3d3LnczLm9yZy8yMDAwL3N2ZyI+PC9zdmc+" /></div> </figure> </div> <h3 style="font-size:20px;text-align:center;font-family:Abril Fatface;font-weight:400;font-style:normal;" class="vc_custom_heading">Chirurgie Esthétique Dentaire</h3> <div class="wpb_text_column wpb_content_element  vc_custom_1657786717341"> <div class="wpb_wrapper"> <p style="text-align:justify;font-size:1.2em;">La <strong>dentisterie esthétique en Tunisie</strong> comprend tous les soins dentaires à visée esthétique. En effet, la chirurgie dentaire permet de redonner aux dents la couleur blanche et le parfait alignement. Grâce à la pose de facettes, de couronne ou d&rsquo;implant dentaire, le patient retrouvera un parfaite dentition.</p> </div> </div> </div></div></div><div class="wpb_column vc_column_container vc_col-sm-4"><div class="vc_column-inner vc_custom_1650894415376"><div class="wpb_wrapper"> <div class="wpb_single_image wpb_content_element vc_align_center"> <figure class="wpb_wrapper vc_figure"> <div class="vc_single_image-wrapper   vc_box_border_grey"><img width="300" height="200" alt="greffe de cheveux Tunisie" nitro-lazy-src="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/04/greffe-de-cheveux.jpg" class="vc_single_image-img attachment-medium nitro-lazy" nitro-lazy-empty id="Mzk5OjI4Ng==-1" src="data:image/svg+xml;nitro-empty-id=Mzk5OjI4Ng==-1;base64,PHN2ZyB2aWV3Qm94PSIwIDAgMzAwIDIwMCIgd2lkdGg9IjMwMCIgaGVpZ2h0PSIyMDAiIHhtbG5zPSJodHRwOi8vd3d3LnczLm9yZy8yMDAwL3N2ZyI+PC9zdmc+" /></div> </figure> </div> <h3 style="font-size:20px;text-align:center;font-family:Abril Fatface;font-weight:400;font-style:normal;" class="vc_custom_heading vc_custom_1658328775244"><a href="">Greffe de cheveux</a></h3> <div class="wpb_text_column wpb_content_element  vc_custom_1658328796053"> <div class="wpb_wrapper"> <p style="text-align:justify;font-size:1.2em;">En effet, la <a href="https://www.chirurgies-esthetique-entunisie.com/greffe-de-cheveux-tunisie/"><strong>greffe de cheveux</strong></a> est la spécialité la plus populaire en médecine esthétique en Tunisie. Grâce à l&rsquo;évolution médical de haute précision, l&rsquo;agence «&nbsp;chirurgie esthetique Tunisie&nbsp;» vous offre des résultats surprenants, pour les cheveux comme pour la barbe.</p> </div> </div> </div></div></div><div class="wpb_column vc_column_container vc_col-sm-4"><div class="vc_column-inner vc_custom_1650894422876"><div class="wpb_wrapper"> <div class="wpb_single_image wpb_content_element vc_align_center"> <figure class="wpb_wrapper vc_figure"> <div class="vc_single_image-wrapper   vc_box_border_grey"><img width="300" height="200" alt="chirurgie esthetique tunisie obesité" nitro-lazy-src="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/04/chirurgie-de-lobesite.jpg" class="vc_single_image-img attachment-medium nitro-lazy" nitro-lazy-empty id="NDExOjMwMg==-1" src="data:image/svg+xml;nitro-empty-id=NDExOjMwMg==-1;base64,PHN2ZyB2aWV3Qm94PSIwIDAgMzAwIDIwMCIgd2lkdGg9IjMwMCIgaGVpZ2h0PSIyMDAiIHhtbG5zPSJodHRwOi8vd3d3LnczLm9yZy8yMDAwL3N2ZyI+PC9zdmc+" /></div> </figure> </div> <h3 style="font-size:20px;text-align:center;font-family:Abril Fatface;font-weight:400;font-style:normal;" class="vc_custom_heading">CHIRURGIE DE L’OBÉSITÉ</h3> <div class="wpb_text_column wpb_content_element  vc_custom_1657786907220"> <div class="wpb_wrapper"> <p style="text-align:justify;font-size:1.2em;">La chirurgie de l’obésité en Tunisie, aide à améliorer la santé des patients en surpoids en leur faisant perdre du poids. De plus, plusieurs techniques sont possibles en <strong>chirurgie bariatrique</strong> en Tunisie comme la Sleeve, le Bypass ou l&rsquo;anneau gastrique.</p> </div> </div> </div></div></div></div><div class="vc_row-full-width vc_clearfix"></div><div data-vc-full-width="true" data-vc-full-width-init="false" class="vc_row wpb_row vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-12"><div class="vc_column-inner"><div class="wpb_wrapper"> <div class="wpb_text_column wpb_content_element"> <div class="wpb_wrapper"> <h2 style="font-size:2em;color:#35769e;">Témoignages en vidéo</h2> </div> </div> <div class="wpb_video_widget wpb_content_element vc_clearfix   vc_video-aspect-ratio-169 vc_video-el-width-100 vc_video-align-center"> <div class="wpb_wrapper"> <div class="wpb_video_wrapper"><iframe title="Témoignages des patients de Chirurgie Esthétique en Tunisie" width="1170" height="878" frameborder="0" allow="accelerometer; autoplay; clipboard-write; encrypted-media; gyroscope; picture-in-picture" allowfullscreen nitro-og-src="https://www.youtube.com/embed/WvSaWijCy6w?feature=oembed&autoplay=1" src="data:text/html;https://www.youtube.com/embed/WvSaWijCy6w?feature=oembed&autoplay=1;base64,PGJvZHkgc3R5bGU9J3dpZHRoOjEwMCU7aGVpZ2h0OjEwMCU7bWFyZ2luOjA7cGFkZGluZzowO2JhY2tncm91bmQ6dXJsKGh0dHBzOi8vaW1nLnlvdXR1YmUuY29tL3ZpL1d2U2FXaWpDeTZ3LzAuanBnKSBjZW50ZXIvMTAwJSBuby1yZXBlYXQnPjxzdHlsZT5ib2R5ey0tYnRuQmFja2dyb3VuZDpyZ2JhKDAsMCwwLC42NSk7fWJvZHk6aG92ZXJ7LS1idG5CYWNrZ3JvdW5kOnJnYmEoMCwwLDApO2N1cnNvcjpwb2ludGVyO30jcGxheUJ0bntkaXNwbGF5OmZsZXg7YWxpZ24taXRlbXM6Y2VudGVyO2p1c3RpZnktY29udGVudDpjZW50ZXI7Y2xlYXI6Ym90aDt3aWR0aDoxMDBweDtoZWlnaHQ6NzBweDtsaW5lLWhlaWdodDo3MHB4O2ZvbnQtc2l6ZTo0NXB4O2JhY2tncm91bmQ6dmFyKC0tYnRuQmFja2dyb3VuZCk7dGV4dC1hbGlnbjpjZW50ZXI7Y29sb3I6I2ZmZjtib3JkZXItcmFkaXVzOjE4cHg7dmVydGljYWwtYWxpZ246bWlkZGxlO3Bvc2l0aW9uOmFic29sdXRlO3RvcDo1MCU7bGVmdDo1MCU7bWFyZ2luLWxlZnQ6LTUwcHg7bWFyZ2luLXRvcDotMzVweH0jcGxheUFycm93e3dpZHRoOjA7aGVpZ2h0OjA7Ym9yZGVyLXRvcDoxNXB4IHNvbGlkIHRyYW5zcGFyZW50O2JvcmRlci1ib3R0b206MTVweCBzb2xpZCB0cmFuc3BhcmVudDtib3JkZXItbGVmdDoyNXB4IHNvbGlkICNmZmY7fTwvc3R5bGU+PGRpdiBpZD0ncGxheUJ0bic+PGRpdiBpZD0ncGxheUFycm93Jz48L2Rpdj48L2Rpdj48c2NyaXB0PmRvY3VtZW50LmJvZHkuYWRkRXZlbnRMaXN0ZW5lcignY2xpY2snLCBmdW5jdGlvbigpe3dpbmRvdy5wYXJlbnQucG9zdE1lc3NhZ2Uoe2FjdGlvbjogJ3BsYXlCdG5DbGlja2VkJ30sICcqJyk7fSk7PC9zY3JpcHQ+PC9ib2R5Pg==" class=""></iframe></div> </div> </div> <div class="vc_btn3-container vc_btn3-center vc_custom_1652885640847"> <a data-vc-gradient-1="#ff6867" data-vc-gradient-2="#23a7de" class="vc_general vc_btn3 vc_btn3-size-lg vc_btn3-shape-round vc_btn3-style-gradient-custom vc_btn-gradient-btn-62f1342964a4d" href="https://www.chirurgies-esthetique-entunisie.com/devis/" title="">Demandez votre devis</a></div> </div></div></div></div><div class="vc_row-full-width vc_clearfix"></div><div data-vc-full-width="true" data-vc-full-width-init="false" class="vc_row wpb_row vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-12"><div class="vc_column-inner"><div class="wpb_wrapper"></div></div></div></div><div class="vc_row-full-width vc_clearfix"></div><div data-vc-full-width="true" data-vc-full-width-init="false" class="vc_row wpb_row vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-12"><div class="vc_column-inner"><div class="wpb_wrapper"> <div class="wpb_text_column wpb_content_element"> <div class="wpb_wrapper"> <h2 style="font-size:1.5em;color:#35769e;">les tarifs des interventions esthétiques en Tunisie</h2> </div> </div> </div></div></div></div><div class="vc_row-full-width vc_clearfix"></div><div data-vc-full-width="true" data-vc-full-width-init="false" class="vc_row wpb_row vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-12"><div class="vc_column-inner"><div class="wpb_wrapper"><div id="sc_table_523205218_wrap" class="sc_table_wrap"><div id="sc_table_523205218" class="sc_table sc_table_default" style="width:100%;"><p></p> <h2 style="font-size:1.5em;color:#35769e;text-align:left;">CHIRURGIE DES SEINS</h2> <table summary="Table example" cellspacing="0"> <tbody> <tr> <th>Intervention</th> <th>Prix</th> <th>Séjour à Tunis</th> </tr> <tr> <td style="text-align:center;">Augmentation mammaire par prothèse mammaires rondes</td> <td style="text-align:center;">2400 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Augmentation mammaire par prothèse mammaires anatomiques</td> <td style="text-align:center;">2500 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Augmentation mammaire par lipofilling&nbsp;avec liposuccion</td> <td style="text-align:center;">2800 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Augmentation mammaire par lipofilling avec liposuccion et Lifting mammaire</td> <td style="text-align:center;">2950 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Augmentation mammaire par prothèses rondes + Lifting mammaire</td> <td style="text-align:center;">2800 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Augmentation mammaire par prothèses anatomiques&nbsp; + lifting mammaire</td> <td style="text-align:center;">3000 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Lifting mammaire</td> <td style="text-align:center;">2100 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Réduction mammaire</td> <td style="text-align:center;">2500 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;"><a href="https://www.chirurgies-esthetique-entunisie.com/gynecomastie-homme-tunisie/">Gynécomastie</a></td> <td style="text-align:center;">1800 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> </tbody> </table> <p></p></div></div></div></div></div></div><div class="vc_row-full-width vc_clearfix"></div><div data-vc-full-width="true" data-vc-full-width-init="false" class="vc_row wpb_row vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-12"><div class="vc_column-inner"><div class="wpb_wrapper"><div id="sc_table_874109267_wrap" class="sc_table_wrap"><div id="sc_table_874109267" class="sc_table sc_table_default" style="width:100%;"><p></p> <h2 style="font-size:1.5em;color:#35769e;text-align:left;">CHIRURGIE DE LA SILHOUETTE</h2> <table summary="Table example" cellspacing="0"> <tbody> <tr> <th>Intervention</th> <th>Prix</th> <th>Séjour à Tunis</th> </tr> <tr> <td style="text-align:center;">Liposuccion une seule zone (ventre…)</td> <td style="text-align:center;">1550 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Liposuccion sur une petite zone (double menton…)</td> <td style="text-align:center;">1450 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Liposuccion sur 3 et 4 zones</td> <td style="text-align:center;">1900 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Liposuccion sur 5 zones et plus</td> <td style="text-align:center;">2050 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Abdominoplastie</td> <td style="text-align:center;">2100 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Abdominoplastie avec liposuccion abdominale</td> <td style="text-align:center;">2800 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Abdominoplastie avec liposuccion complète</td> <td style="text-align:center;">2950 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Augmentation des fesses par implants fessiers</td> <td style="text-align:center;">3400 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Augmentation des fesses par lipofilling avec liposuccion</td> <td style="text-align:center;">2950 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">brazilian butt lift</td> <td style="text-align:center;">2950 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Body Lift</td> <td style="text-align:center;">4000 euros</td> <td style="text-align:center;">6 nuits / 7 jours</td> </tr> <tr> <td style="text-align:center;">Lifting des cuisses</td> <td style="text-align:center;">1600 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Lifting des bras</td> <td style="text-align:center;">1600 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Lifting des cuisses + lifting des bras</td> <td style="text-align:center;">2300 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> </tbody> </table> <p></p></div></div></div></div></div></div><div class="vc_row-full-width vc_clearfix"></div><div data-vc-full-width="true" data-vc-full-width-init="false" class="vc_row wpb_row vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-12"><div class="vc_column-inner"><div class="wpb_wrapper"><div id="sc_table_1898961257_wrap" class="sc_table_wrap"><div id="sc_table_1898961257" class="sc_table sc_table_default" style="width:100%;"><p></p> <h2 style="font-size:1.5em;color:#35769e;text-align:left;">CHIRURGIE DU VISAGE</h2> <table summary="Table example" cellspacing="0"> <tbody> <tr> <th>Intervention</th> <th>Prix</th> <th>Séjour à Tunis</th> </tr> <tr> <td style="text-align:center;">Boule de bichat</td> <td style="text-align:center;">1800 euros</td> <td style="text-align:center;">3 nuits / 4 jours</td> </tr> <tr> <td style="text-align:center;">Lifting cervico-facial</td> <td style="text-align:center;">2400 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Lifting complet (cervico-facial + blépharoplastie 4 paupières)</td> <td style="text-align:center;">3300 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Lipofilling du visage</td> <td style="text-align:center;">2000 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Rhinoplastie simple</td> <td style="text-align:center;">2000 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Rhinoplastie ethnique</td> <td style="text-align:center;">2350 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Rhinoseptoplastie</td> <td style="text-align:center;">2350 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Blépharoplastie 2 paupiéres</td> <td style="text-align:center;">1600 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Blépharoplastie 4 paupiéres</td> <td style="text-align:center;">1800 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Génioplastie de recul</td> <td style="text-align:center;">2100 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Génioplastie d’avancement</td> <td style="text-align:center;">1950 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> <tr> <td style="text-align:center;">Otoplastie</td> <td style="text-align:center;">1500 euros</td> <td style="text-align:center;">4 nuits / 5 jours</td> </tr> </tbody> </table> <p></p></div></div><div class="vc_btn3-container vc_btn3-center vc_custom_1652885640847"> <a data-vc-gradient-1="#ff6867" data-vc-gradient-2="#23a7de" class="vc_general vc_btn3 vc_btn3-size-lg vc_btn3-shape-round vc_btn3-style-gradient-custom vc_btn-gradient-btn-62f13429659fc" href="https://www.chirurgies-esthetique-entunisie.com/devis/" title="">Demandez votre devis</a></div> <div class="wpb_text_column wpb_content_element"> <div class="wpb_wrapper"> <h2 style="font-size:1.5em;color:#35769e;text-align:left;">les meilleurs chirurgiens esthétiques en Tunisie</h2> <p style="text-align:left;font-size:1.2em;">Tout d&rsquo;abord, notre agence travaille avec les <strong>meilleurs chirurgiens esthétiques de Tunisie</strong>. En effet, nos chirurgiens tunisiens sont formés à toutes les techniques modernes et avancées en chirurgie esthétique. De plus, nos chirurgiens sauront vous conseiller et s&rsquo;adapter à votre morphologie et à vos attentes pour un <a href="https://www.chirurgies-esthetique-entunisie.com/chirurgie-esthetique-avant-apres/">résultat naturel et raffiné</a>.</p> <h2 style="font-size:1.5em;color:#35769e;text-align:left;">Chirurgie esthétique en Tunisie : Prix bas et bien moins cher qu’en France</h2> <p style="text-align:left;font-size:1.2em;">Depuis un certain temps, vous êtes dans le besoin ou vous avez envie de faire une <strong>intervention de chirurgie esthetique</strong>. Alors, sauriez-vous intriguer de savoir comment réaliser ce rêve sans vous ruiner ?<br /> Du coup, quelque soit le type de votre intervention chirurgicale, vous pouvez vous rendre en Tunisie pour un séjour médical tout compris. Mais aussi vous pouvez profiter d’une chirurgie esthétique à prix pas cher en toute sécurité et tranquillité.<br /> En effet, le principe d’une<strong> chirurgie réparatrice plastique</strong> de qualité à l’étranger, notamment de chirurgie esthetique Tunisie, n’est plus impossible.</p> <p style="text-align:left;font-size:1.2em;">Alors, surtout ne renoncez pas à votre projet d’intervention à cause des prix classiques que vous trouverez en France.<br /> De plus, avec chirurgie esthétique Tunisie, vous profiterez aussi du savoir-faire d’un <strong>chirurgien confirmé à prix pas cher</strong>.</p> </div> </div> </div></div></div></div><div class="vc_row-full-width vc_clearfix"></div><div data-vc-full-width="true" data-vc-full-width-init="false" class="vc_row wpb_row vc_row-fluid"><div class="wpb_column vc_column_container vc_col-sm-12"><div class="vc_column-inner"><div class="wpb_wrapper"> <div class="wpb_text_column wpb_content_element"> <div class="wpb_wrapper"> <h2 style="font-size:1.5em;color:#35769e;text-align:left;">La chirurgie plastique et réparatrice en Tunisie y compris le séjour médical tout inclus</h2> <p style="text-align:left;font-size:1.2em;">En effet, en choisissant chirurgie esthétique Tunisie, vous allez pouvoir profiter du <strong>meilleur séjour médical</strong> dans un hôtel 5 étoiles en pension complète.</p> <p style="text-align:left;font-size:1.2em;">De plus, lors de vos <strong>opérations de chirurgie esthétique</strong> avec notre agence, vous allez pouvoir bénéficier de :<br /> _ Tout d&rsquo;abord, d&rsquo;un suivi personnalisé tout au long du séjour,<br /> _ Aussi, d&rsquo;un logement VIP dans un hôtel de luxe en Tunisie,<br /> _ Mais aussi, la préparation du séjour et de l&rsquo;intervention par des professionnels de la santé et du chirurgien plasticien,<br /> _ Ainsi que l’assistance et le transport sont assurés 24h/24 et 7j/7,<br /> _ Et pour finir, des <strong>tarifs de prix 60% moins chers qu’en France</strong> y compris le séjour.</p> </div> </div> </div></div></div></div><div class="vc_row-full-width vc_clearfix"></div><div data-vc-full-width="true" data-vc-full-width-init="false" class="vc_row wpb_row vc_row-fluid vc_custom_1638370981015"><div class="wpb_column vc_column_container vc_col-sm-12"><div class="vc_column-inner"><div class="wpb_wrapper"> <div class="wpb_text_column wpb_content_element  vc_custom_1657787339073"> <div class="wpb_wrapper"> <p><img alt="SATISFACTION EST GARANTIE EN CHIRURGIE PLASTIQUE en tunisie" width="1000" height="563" sizes="(max-width: 1000px) 100vw, 1000px" nitro-lazy-srcset="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/05/shutterstock_1026939466.jpg 1000w, https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/05/shutterstock_1026939466-300x169.jpg 300w, https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/05/shutterstock_1026939466-768x432.jpg 768w, https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/05/shutterstock_1026939466-370x208.jpg 370w, https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/05/shutterstock_1026939466-740x416.jpg 740w, https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/05/shutterstock_1026939466-770x434.jpg 770w, https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/05/shutterstock_1026939466-270x152.jpg 270w" nitro-lazy-src="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2022/05/shutterstock_1026939466.jpg" class="aligncenter wp-image-4253 size-full nitro-lazy" nitro-lazy-empty id="Njc3OjExMzI=-1" src="data:image/svg+xml;nitro-empty-id=Njc3OjExMzI=-1;base64,PHN2ZyB2aWV3Qm94PSIwIDAgMTAwMCA1NjMiIHdpZHRoPSIxMDAwIiBoZWlnaHQ9IjU2MyIgeG1sbnM9Imh0dHA6Ly93d3cudzMub3JnLzIwMDAvc3ZnIj48L3N2Zz4=" /></p> <h2 style="font-size:1.5em;color:#35769e;text-align:left;">En Tunisie, la satisfaction est garantie en chirurgie plastique</h2> <p style="text-align:left;font-size:1.2em;">Alors, si vous êtes à la recherche d’une <strong>agence pour des soins en chirurgie plastique ou esthétique en Tunisie</strong> ? Dans ce cas, nous serions de satisfaire nos clients venus tous des quatre coins du monde. En effet, aujourd&rsquo;hui notre agence est l’une des agences ayant un niveau de satisfaction très élevé et en constante évolution.</p> <p style="text-align:left;font-size:1.2em;">En effet, grâce à notre expertise et notre sélection rigoureuse des partenaires, nous proposons fièrement un parfait savoir-faire. De plus, nous travaillons avec les meilleurs chirurgiens esthétiques et les spécialistes tunisiens les plus reconnus. De plus, nous faisons confiance à une <strong>clinique esthétique moderne</strong> et répondant aux conditions d&rsquo;hygiène les plus strictes.<br /> En effet, aujourd’hui la France n’a jamais cessée de faire confiance à la Tunisie. De plus, elle l’a considère comme une destination sûre et idéale pour la <strong>chirurgie réparatrice et plastique</strong>. Du coup, pour mieux répondre à vos exigences, nous avons mis en place notre charte qualité engagée.</p> <h3 style="font-size:1.2em;color:#35769e;text-align:left;">Chirurgie esthetique en Tunisie, votre idéal partenaire pour toutes vos opérations chirurgicales en Tunisie sans aucune complication !</h3> <p style="text-align:left;font-size:1.2em;">En effet, en nous faisant confiance nous vous assurons aussi l’assistance pré et post opératoire par téléphone et en personne. Au final, notre priorité est que vous vous sentiez apaisé et accompagné.</p> <p style="text-align:left;font-size:1.2em;">Alors, que ce soit pour une <strong>chirurgie esthétique du visage</strong>, un lifting du visage, une augmentation mammaire, une réduction mammaire, une chirurgie intime…. l’agence chirurgie esthétique Tunisie met tout son savoir-faire en proposant à leurs patients :<br /> _ Premièrement, de fournir les <strong>meilleures procédures chirurgicales</strong> et les meilleurs traitements cosmétiques avec éthique et qualité<br /> _ Deuxièmement, de maintenir les meilleures pratiques médicales,<br /> _ Mais aussi d&#8217;employer les technologies les plus avancées dans les différentes procédures effectuées</p> <p style="text-align:left;font-size:1.2em;">De plus, nos chirurgiens spécialistes sont nos partenaires qui ont à cœur la satisfaction des patients.<br /> Et pour finir et afin de garantir toute l&rsquo;efficacité de la <strong>chirurgie plastique esthétique</strong>, nous disposons :<br /> _ Premièrement, d&rsquo;installations modernes équipées de bloc opératoire à la pointe de la technologie<br /> _ Deuxièmement d&rsquo;équipes professionnelles dédiées aux soins des patients.</p> </div> </div> </div></div></div></div><div class="vc_row-full-width vc_clearfix"></div><div data-vc-full-width="true" data-vc-full-width-init="false" class="vc_row wpb_row vc_row-fluid vc_custom_1638370981015"><div class="wpb_column vc_column_container vc_col-sm-12"><div class="vc_column-inner"><div class="wpb_wrapper"> <div class="wpb_text_column wpb_content_element"> <div class="wpb_wrapper"> <h2 style="text-align:center;">Nos avantages</h2> </div> </div> </div></div></div></div><div class="vc_row-full-width vc_clearfix"></div><div data-vc-full-width="true" data-vc-full-width-init="false" class="vc_row wpb_row vc_row-fluid vc_custom_1638370981015"><div class="wpb_column vc_column_container vc_col-sm-3"><div class="vc_column-inner"><div class="wpb_wrapper"> <div class="wpb_text_column wpb_content_element"> <div class="wpb_wrapper"> <p><img title="DISPONIBILITÉ 24/7" alt="tjr dispo" width="55" height="56" sizes="(max-width: 55px) 100vw, 55px" nitro-lazy-srcset="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2021/12/TOUJOURS-DISPONIBLE.png 110w, https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2021/12/TOUJOURS-DISPONIBLE-90x90.png 90w" nitro-lazy-src="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2021/12/TOUJOURS-DISPONIBLE.png" class="aligncenter wp-image-3887 size-full nitro-lazy" nitro-lazy-empty id="NzAzOjUwMg==-1" src="data:image/svg+xml;nitro-empty-id=NzAzOjUwMg==-1;base64,PHN2ZyB2aWV3Qm94PSIwIDAgMTEwIDExMSIgd2lkdGg9IjExMCIgaGVpZ2h0PSIxMTEiIHhtbG5zPSJodHRwOi8vd3d3LnczLm9yZy8yMDAwL3N2ZyI+PC9zdmc+" /></p> </div> </div> <div class="wpb_text_column wpb_content_element  vc_custom_1651756118013"> <div class="wpb_wrapper"> <p style="text-align:center;font-size:1.2em;"><strong>Toujours joignables 24h/24 &amp; 7j/7</strong></p> <p style="text-align:justify;font-size:1.2em;">Nous mettons à votre disposition notre équipe de conseillers clients 24h/24 et 7j/7 qui se fera un plaisir de toujours répondre à vos besoins et à toutes vos questions.</p> </div> </div> </div></div></div><div class="wpb_column vc_column_container vc_col-sm-3"><div class="vc_column-inner"><div class="wpb_wrapper"> <div class="wpb_text_column wpb_content_element"> <div class="wpb_wrapper"> <p><img title="santé" alt="active" width="55" height="56" nitro-lazy-src="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2021/12/CONSEILLERS-QUALIFIES.png" class="wp-image-3888 size-full aligncenter nitro-lazy" nitro-lazy-empty id="NzE1OjIyNw==-1" src="data:image/svg+xml;nitro-empty-id=NzE1OjIyNw==-1;base64,PHN2ZyB2aWV3Qm94PSIwIDAgMTE1IDExMCIgd2lkdGg9IjExNSIgaGVpZ2h0PSIxMTAiIHhtbG5zPSJodHRwOi8vd3d3LnczLm9yZy8yMDAwL3N2ZyI+PC9zdmc+" /></p> </div> </div> <div class="wpb_text_column wpb_content_element  vc_custom_1651756155742"> <div class="wpb_wrapper"> <p style="text-align:center;font-size:1.2em;"><strong>Une compétente équipe médicale</strong></p> <p style="text-align:justify;font-size:1.2em;">Notre équipe médicale et nos chirurgiens spécialistes se feront un plaisir de vous chouchouter et de prendre soin de vous et de répondre à toutes vos attentes et demandes.</p> </div> </div> </div></div></div><div class="wpb_column vc_column_container vc_col-sm-3"><div class="vc_column-inner"><div class="wpb_wrapper"> <div class="wpb_text_column wpb_content_element"> <div class="wpb_wrapper"> <p><img title="rapports qualité/Prix" alt="PRIX" width="55" height="56" nitro-lazy-src="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2021/12/PRIX-RAISONNABLES.png" class="wp-image-3889 size-full aligncenter nitro-lazy" nitro-lazy-empty id="NzI3OjIzNw==-1" src="data:image/svg+xml;nitro-empty-id=NzI3OjIzNw==-1;base64,PHN2ZyB2aWV3Qm94PSIwIDAgMTE2IDExMCIgd2lkdGg9IjExNiIgaGVpZ2h0PSIxMTAiIHhtbG5zPSJodHRwOi8vd3d3LnczLm9yZy8yMDAwL3N2ZyI+PC9zdmc+" /></p> </div> </div> <div class="wpb_text_column wpb_content_element  vc_custom_1651756164787"> <div class="wpb_wrapper"> <p style="text-align:center;font-size:1.2em;"><strong>Rapport qualité-prix attractif</strong></p> <p style="text-align:justify;font-size:1.2em;">Nous vous proposons des tarifs tout compris très intéressants et des packages à des prix très abordables et bas. Pour plus d&rsquo;infos, vous pouvez nous contacter ou vous renseigner sur nos tarifs.</p> </div> </div> </div></div></div><div class="wpb_column vc_column_container vc_col-sm-3"><div class="vc_column-inner"><div class="wpb_wrapper"> <div class="wpb_text_column wpb_content_element"> <div class="wpb_wrapper"> <p><img alt="OFFRES" width="55" height="56" nitro-lazy-src="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2021/12/OFFRES-IMBATTABLES.png" class="wp-image-3890 size-full aligncenter nitro-lazy" nitro-lazy-empty id="NzM5OjIwOQ==-1" src="data:image/svg+xml;nitro-empty-id=NzM5OjIwOQ==-1;base64,PHN2ZyB2aWV3Qm94PSIwIDAgMTE2IDExMiIgd2lkdGg9IjExNiIgaGVpZ2h0PSIxMTIiIHhtbG5zPSJodHRwOi8vd3d3LnczLm9yZy8yMDAwL3N2ZyI+PC9zdmc+" /></p> </div> </div> <div class="wpb_text_column wpb_content_element  vc_custom_1651756177009"> <div class="wpb_wrapper"> <p style="text-align:center;font-size:1.2em;"><strong>Un séjour médical personnalisé</strong></p> <p style="text-align:justify;font-size:1.2em;">Votre intervention sera réalisée dans les meilleures cliniques esthétiques de Tunisie. De plus, nous vous offrons un séjour agréable et relaxant dans nos hôtels les plus charmants.</p> </div> </div> </div></div></div></div><div class="vc_row-full-width vc_clearfix"></div><div data-vc-full-width="true" data-vc-full-width-init="false" class="vc_row wpb_row vc_row-fluid vc_custom_1638370981015"><div class="wpb_column vc_column_container vc_col-sm-12"><div class="vc_column-inner"><div class="wpb_wrapper"> <div class="wpb_text_column wpb_content_element"> <div class="wpb_wrapper"> <div id="sp-ea-4002" class="sp-ea-one sp-easy-accordion" data-ex-icon="fa-minus" data-col-icon="fa-plus" data-ea-active="ea-click" data-ea-mode="vertical" data-preloader=""><div class="ea-card  sp-ea-single"><h3 class="ea-header"><a class="collapsed" data-sptoggle="spcollapse" data-sptarget=#collapse40020 href="javascript:void(0)" aria-expanded="false"><i class="ea-expand-icon fa fa-plus"></i> Que pensez-vous de la chirurgie esthétique en Tunisie?</a></h3><div class="sp-collapse spcollapse spcollapse" id="collapse40020" data-parent=#sp-ea-4002><div class="ea-body"><p style="font-size:1.2em;">Avec Chirurgie Esthétique Tunisie, vous n’aurez qu’à préparez votre valise et venir en Tunisie. Grâce à nos conseillers médicaux professionnels et expérimentés, nous vous proposons :</p> <p></p> <p style="font-size:1.2em;">- Un devis gratuit sans engagement,</p> <p></p> <p style="font-size:1.2em;">- Un tarif défiant toute concurrence,</p> <p></p> <p style="font-size:1.2em;">- Une pris en charge totale depuis votre arrivée jusqu’à votre départ de Tunis,</p> <p></p> <p style="font-size:1.2em;">- Un hébergement dans un hôtel grand luxe,</p> <p></p> <p style="font-size:1.2em;">- Une hospitalisation dans des cliniques hauts standings,</p> <p></p> <p style="font-size:1.2em;">- Des chirurgiens qualifiés et formés en France seront à votre service.</p> </div></div></div><div class="ea-card  sp-ea-single"><h3 class="ea-header"><a class="collapsed" data-sptoggle="spcollapse" data-sptarget=#collapse40021 href="javascript:void(0)" aria-expanded="false"><i class="ea-expand-icon fa fa-plus"></i> Comment faire une chirurgie esthetique en Tunisie ?</a></h3><div class="sp-collapse spcollapse spcollapse" id="collapse40021" data-parent=#sp-ea-4002><div class="ea-body"><p style="font-size:1.2em;">Pour l’organisation d’un séjour médical en Tunisie et plus précisément pour votre opération de chirurgie esthétique, la démarche est bien simple si vous faites confiance à notre agence.</p> <p></p> <p style="font-size:1.2em;">De plus, avec l'aide de nos conseillers vous allez pouvoir vous organiser un séjour sur mesure et réaliser l'opération de chirurgie esthétique de votre vie en toute confiance et sérénité.</p> <p></p> <p style="font-size:1.2em;">En effet, en cliquant et en remplissant le formulaire de devis gratuit, un de nos conseillers vous contactera et vous prendra en charge.</p> <p></p> <p style="font-size:1.2em;">Dans notre agence demander votre devis gratuitement ne vous engagera en rien.</p> </div></div></div><div class="ea-card  sp-ea-single"><h3 class="ea-header"><a class="collapsed" data-sptoggle="spcollapse" data-sptarget=#collapse40022 href="javascript:void(0)" aria-expanded="false"><i class="ea-expand-icon fa fa-plus"></i> Quelles sont les meilleures cliniques en Tunisie ?</a></h3><div class="sp-collapse spcollapse spcollapse" id="collapse40022" data-parent=#sp-ea-4002><div class="ea-body"><p style="font-size:1.2em;">Les cliniques en Tunisie sont de plus en plus nombreuses surtout ceux qui se sont spécialisées dans la chirurgie esthétique.</p> <p></p> <p style="font-size:1.2em;">En effet, pour pouvoir choisir la meilleure clinique si vous projetez de vous offrir une chirurgie esthétique à Tunis, il est conseillé de se renseigner sur quelques critères primordiaux :</p> <p></p> <p style="font-size:1.2em;">1- La spécialité de la clinique,</p> <p></p> <p style="font-size:1.2em;">2- Les normes sanitaires,</p> <p></p> <p style="font-size:1.2em;">3- L’état de la clinique,</p> <p></p> <p style="font-size:1.2em;">4- Le type d’équipements,</p> <p></p> <p style="font-size:1.2em;">5- Etc.….</p> <p></p> <p style="font-size:1.2em;">En effet, pour avoir des détails sur ces critères tout d’abord c’est l’avis de l’agence et du chirurgien sont à prendre en compte. Mais aussi, il faudra faire une petite recherche sur internet, les réseaux sociaux.</p> </div></div></div><div class="ea-card  sp-ea-single"><h3 class="ea-header"><a class="collapsed" data-sptoggle="spcollapse" data-sptarget=#collapse40023 href="javascript:void(0)" aria-expanded="false"><i class="ea-expand-icon fa fa-plus"></i> Pourquoi les prix sont beaucoup moins chers qu’en Europe ?</a></h3><div class="sp-collapse spcollapse spcollapse" id="collapse40023" data-parent=#sp-ea-4002><div class="ea-body"><p style="font-size:1.2em;">En effet, lorsque vous prévoyez de vous offrir une chirurgie esthétique en Tunisie, vous aurez la possibilité d’économiser 50 à 60% par rapport à la France et toute l’Europe. De plus, il faut savoir que certes les prix ne sont pas chers mais ça inclus aussi l’offre «&nbsp;tout compris&nbsp;».<br /> Ce qui veut dire que vous allez payer moins tout en bénéficiant des mêmes services proposés en Europe.</p> </div></div></div><div class="ea-card  sp-ea-single"><h3 class="ea-header"><a class="collapsed" data-sptoggle="spcollapse" data-sptarget=#collapse40024 href="javascript:void(0)" aria-expanded="false"><i class="ea-expand-icon fa fa-plus"></i> Interventions esthétiques pas chères en Tunisie, mais comment être garant de la qualité ?</a></h3><div class="sp-collapse spcollapse spcollapse" id="collapse40024" data-parent=#sp-ea-4002><div class="ea-body"><p style="font-size:1.2em;">En effet, pour profiter d'une chirurgie esthétique peu coûteuse, deux facteurs contribuent au succès de l'intervention, à savoir son déroulement dans des conditions optimales. Un chirurgien praticien doit être qualifié, agréé et expérimenté. C'est le cas de nos chirurgiens&nbsp;!<br /> De plus, la procédure doit également être effectuée dans une clinique de renommée.<br /> Pour finir, Chirurgie Esthetique Tunisie vous a sélectionné&nbsp; des cliniques à la pointe de la technologie avec des équipements ultramodernes, des blocs chirurgicaux et des installations de couchage et d'hygiène absolument parfaites.</p> </div></div></div></div> </div> </div> </div></div></div></div><div class="vc_row-full-width vc_clearfix"></div><div data-vc-full-width="true" data-vc-full-width-init="false" class="vc_row wpb_row vc_row-fluid vc_custom_1638291476769 vc_row-has-fill"><div class="wpb_column vc_column_container vc_col-sm-12"><div class="vc_column-inner"><div class="wpb_wrapper"><div id="sc_promo_292875646" class="sc_promo sc_promo_default promo-bottom sc_promo_size_normal sc_promo_image_position_left"><div style="background-image:url(&quot;data:image/gif;base64,R0lGODlhAQABAIABAAAAAP///yH5BAEAAAEALAAAAAABAAEAAAICTAEAOw==&quot;);width:54.5%;left:0;" class="sc_promo_image nitro-lazy" nitro-lazy-bg="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/uploads/2021/12/Docteur.png"></div><div class="sc_promo_text trx_addons_stretch_height" style="width:45%;float:right;"> <div class="sc_promo_text_inner" style=""><h3 class="sc_item_title sc_promo_title sc_align_default sc_item_title_style_default">Demandez votre devis gratuit</h3><div class="sc_promo_content sc_item_content"><div role="form" class="wpcf7" id="wpcf7-f776-p319-o1" lang="fr-FR" dir="ltr"> <div class="screen-reader-response"><p role="status" aria-live="polite" aria-atomic="true"></p> <ul></ul></div> <form action="/#wpcf7-f776-p319-o1" method="post" class="wpcf7-form init" enctype="multipart/form-data" novalidate="novalidate" data-status="init"> <div style="display:none;"> <input type="hidden" name="_wpcf7" value="776" /> <input type="hidden" name="_wpcf7_version" value="5.6.1" /> <input type="hidden" name="_wpcf7_locale" value="fr_FR" /> <input type="hidden" name="_wpcf7_unit_tag" value="wpcf7-f776-p319-o1" /> <input type="hidden" name="_wpcf7_container_post" value="319" /> <input type="hidden" name="_wpcf7_posted_data_hash" value="" /> </div> <p><span class="wpcf7-form-control-wrap" data-name="nom"><input type="text" name="nom" value="" size="40" class="wpcf7-form-control wpcf7-text wpcf7-validates-as-required" aria-required="true" aria-invalid="false" placeholder="(*) Nom et prénom" /></span><label style="display:none;"><span class="wpcf7-form-control-wrap" data-name="tel"><input type="tel" name="tel" value="" size="40" class="wpcf7-form-control wpcf7-text wpcf7-tel wpcf7-validates-as-tel" aria-invalid="false" placeholder="Téléphone" /></span></label><span class="wpcf7-form-control-wrap tel"><input type="text" name="tel" value="" size="40" class="wpcf7-form-control wpcf7-text wpcf7-phonetext wpcf7-validates-as-required" aria-required="true" aria-invalid="false" placeholder="(*) Téléphone" /><input type="hidden" name="tel-country-code" class="wpcf7-phonetext-country-code" /></span><span class="wpcf7-form-control-wrap" data-name="your-email"><input type="email" name="your-email" value="" size="40" class="wpcf7-form-control wpcf7-text wpcf7-email wpcf7-validates-as-required wpcf7-validates-as-email" aria-required="true" aria-invalid="false" placeholder="(*) Email" /></span><label style="display:none;"><span class="wpcf7-form-control-wrap" data-name="oldPays"><select name="oldPays" class="wpcf7-form-control wpcf7-select" aria-invalid="false"><option value="France">France</option><option value="Belgique">Belgique</option><option value="Suisse">Suisse</option><option value="Canada">Canada</option><option value="Luxembourg">Luxembourg</option><option value="Monaco">Monaco</option><option value="Suède">Suède</option><option value="Andorre">Andorre</option><option value="Algérie">Algérie</option><option value="Royaume-Uni">Royaume-Uni</option><option value="États-Unis">États-Unis</option><option value="Cameroun">Cameroun</option><option value="Ivory-Coast">Ivory-Coast</option><option value="Mali">Mali</option><option value="Sénégal">Sénégal</option><option value="Bénin">Bénin</option><option value="Guinée">Guinée</option><option value="Gabon">Gabon</option><option value="Burkina-Faso">Burkina-Faso</option></select></span></label><span class="wpcf7-form-control-wrap Pays"><input type="text" name="Pays" value="" size="40" class="wpcf7-form-control wpcf7-text wpcf7-countrytext" aria-invalid="false" /></span><span class="wpcf7-form-control-wrap" data-name="message"><textarea name="message" cols="40" rows="10" class="wpcf7-form-control wpcf7-textarea wpcf7-validates-as-required" aria-required="true" aria-invalid="false" placeholder="(*) Interventions souhaitées"></textarea></span><label style="display:none;"><span class="wpcf7-form-control-wrap" data-name="typesoumission"><input type="text" name="typesoumission" value="lead" size="40" class="wpcf7-form-control wpcf7-text" aria-invalid="false" /></span></label><label style="display:none;"><span class="wpcf7-form-control-wrap" data-name="namepiste"><input type="text" name="namepiste" value="Nouvelle Piste ChEsTuCom" size="40" class="wpcf7-form-control wpcf7-text" aria-invalid="false" /></span></label><br /> <span class="info">Télécharger un fichier (ex: dossier médical si besoin)</span> </p><div class="input-file-container"><span class="wpcf7-form-control-wrap" data-name="Dossiermdical"><input type="file" name="Dossiermdical" size="40" class="wpcf7-form-control wpcf7-file input-file" id="dossier-medical" accept="audio/*,video/*,image/*" aria-invalid="false" /></span><label tabindex="0" for="my-cv" class="input-file-trigger">Choisir un fichier</label></div> <div id="file-return" class="file-return"></div> <p><span class="wpcf7-form-control-wrap chapter"><input type="hidden" name="chapter" value="Accueil" size="40" class="wpcf7-form-control wpcf7dtx-dynamictext wpcf7-dynamichidden" aria-invalid="false" /></span> <input type="hidden" name="hiddenurl" value="post_url" class="wpcf7-form-control wpcf7-hidden" /> </p><p><span class="wpcf7-form-control-wrap GetParamFromUrl1"><input type="hidden" name="GetParamFromUrl1" value="" size="40" class="wpcf7-form-control wpcf7dtx-dynamictext wpcf7-dynamichidden" id="GetParamFromUrl1" aria-invalid="false" /></span><span class="wpcf7-form-control-wrap GetParamFromUrl2"><input type="hidden" name="GetParamFromUrl2" value="" size="40" class="wpcf7-form-control wpcf7dtx-dynamictext wpcf7-dynamichidden" id="GetParamFromUrl2" aria-invalid="false" /></span><span class="wpcf7-form-control-wrap GetParamFromUrl3"><input type="hidden" name="GetParamFromUrl3" value="" size="40" class="wpcf7-form-control wpcf7dtx-dynamictext wpcf7-dynamichidden" id="GetParamFromUrl3" aria-invalid="false" /></span><span class="wpcf7-form-control-wrap GetParamFromUrl4"><input type="hidden" name="GetParamFromUrl4" value="" size="40" class="wpcf7-form-control wpcf7dtx-dynamictext wpcf7-dynamichidden" id="GetParamFromUrl4" aria-invalid="false" /></span><br /> </p><div id="cf7sr-62f13429680c4" class="cf7sr-g-recaptcha" data-sitekey="6LdufogfAAAAAI4JR09dTWx8o4SHmN12lT55aMf9"></div><span class="wpcf7-form-control-wrap cf7sr-recaptcha" data-name="cf7sr-recaptcha"><input type="hidden" name="cf7sr-recaptcha" value="" class="wpcf7-form-control" /></span><br /> <input type="submit" value="Envoyer" class="wpcf7-form-control has-spinner wpcf7-submit" /><span class="rappel green">NOUS VOUS rappellerons</span><p></p> <div class="wpcf7-response-output" aria-hidden="true"></div></form></div></div></div> </div></div></div></div></div></div><div class="vc_row-full-width vc_clearfix"></div> </div> </article> <script nitro-exclude>
    document.cookie = 'nitroCachedPage=' + (!window.NITROPACK_STATE ? '0' : '1') + '; path=/';
</script> <script nitro-exclude>
    if (!window.NITROPACK_STATE || window.NITROPACK_STATE != 'FRESH') {
        var proxyPurgeOnly = 0;
        if (typeof navigator.sendBeacon !== 'undefined') {
            var nitroData = new FormData(); nitroData.append('nitroBeaconUrl', 'aHR0cHM6Ly93d3cuY2hpcnVyZ2llcy1lc3RoZXRpcXVlLWVudHVuaXNpZS5jb20v'); nitroData.append('nitroBeaconCookies', 'W10='); nitroData.append('nitroBeaconHash', 'b7963988f290b9ce7ddc10c4c7b672e27dca6ac4442ccda579f66d339b112012490558eb08735a71105586ec7e0bd18a1cac2ec0f8c2ee0053232f471ee9035a'); nitroData.append('proxyPurgeOnly', ''); nitroData.append('layout', 'home'); navigator.sendBeacon(location.href, nitroData);
        } else {
            var xhr = new XMLHttpRequest(); xhr.open('POST', location.href, true); xhr.setRequestHeader('Content-Type', 'application/x-www-form-urlencoded'); xhr.send('nitroBeaconUrl=aHR0cHM6Ly93d3cuY2hpcnVyZ2llcy1lc3RoZXRpcXVlLWVudHVuaXNpZS5jb20v&nitroBeaconCookies=W10=&nitroBeaconHash=b7963988f290b9ce7ddc10c4c7b672e27dca6ac4442ccda579f66d339b112012490558eb08735a71105586ec7e0bd18a1cac2ec0f8c2ee0053232f471ee9035a&proxyPurgeOnly=&layout=home');
        }
    }
</script> </div> </div> </div> <footer class="site_footer_wrap scheme_default"> <div class="footer_wrap widget_area"> <div class="footer_wrap_inner widget_area_inner"> <div class="content_wrap"><div class="columns_wrap"><aside id="text-4" class="column-1_3 widget widget_text"> <div class="textwidget"><p style="text-align:justify;font-size:1.2em;"><strong>Chirurgie esthétique Tunisie</strong></p> <p style="text-align:justify;font-size:1.2em;">L&rsquo;agence Chirurgie Esthétique Tunisie est une agence de tourisme médical en Tunisie. Cette agence propose au patient venus des 4 coins du monde&nbsp; de bénéficier des meilleurs offres et prestations en chirurgie esthétique afin d&rsquo;harmoniser leur corpulence.</p> </div> </aside><aside id="text-6" class="column-1_3 widget widget_text"> <div class="textwidget"><p style="text-align:justify;font-size:1.2em;"><strong>Informations</strong></p> <p style="text-align:justify;font-size:1.2em;">Disponible 24/7<br /> Email : <a href="mailto:contact@chirurgies-esthetique-entunisie.com">contact@chirurgies-esthetique-entunisie.com</a></p> </div> </aside><aside id="text-7" class="column-1_3 widget widget_text"> <div class="textwidget"><p style="text-align:justify;font-size:1.2em;"><strong>A Propos</strong></p> <p style="text-align:justify;font-size:1.2em;">Le site «&nbsp;Chirurgie esthétique Tunisie&nbsp;» propose des prestations et des offres sur mesure pour une chirurgie sur mesure pour corriger toute disgrâce corporelle et tout cela est offert à prix abordables. En choisissant nos services vous profiterez d&rsquo;offres très intéressantes et bien d&rsquo;autres avantages.</p> </div> </aside></div></div> </div> </div> <div class="copyright_wrap scheme_"> <div class="copyright_wrap_inner"> <div class="content_wrap"> <div class="copyright_text">© Tous les droits sont réservés.</div> <div class="copyright_socials"></div> </div> </div> </div> </footer> </div> </div><script nitro-exclude>(function(){var e=[];var a={};var r=null;var i={enabled:true,observeSelectors:['[class*="slider"]','[id*="slider"]',".fotorama",".esg-grid"],attributes:["src","data-src"],attributeRegex:/^data:image\/.*?;nitro-empty-id=([^;]*);base64/,cssUrlFuncRegex:/^url\(['|"]data:image\/.*?;nitro-empty-id=([^;]*);base64/};var l=function(t){setTimeout(t,0)};var t=function(){document.querySelectorAll("[nitro-lazy-empty]").forEach(function(t){let e=t.getAttribute("nitro-lazy-src");let r=t.getAttribute("id");if(r&&e){a[r]=e}});r=new MutationObserver(n);let e=document.querySelectorAll(i.observeSelectors.join(","));for(let t=0;t<e.length;++t){r.observe(e[t],{subtree:true,childList:true,attributes:true,attributeFilter:i.attributes,characterData:false,attributeOldValue:false,characterDataOldValue:false})}};var n=function(a){for(let r=0;r<a.length;++r){switch(a[r].type){case"attributes":let t=a[r].target.getAttribute(a[r].attributeName);if(!t)break;let e=i.attributeRegex.exec(t);if(e&&e[1]){a[r].target.setAttribute("nitro-lazy-"+a[r].attributeName,u(e[1]));if(a[r].target.className.indexOf("nitro-lazy")<0){a[r].target.className+=" nitro-lazy"}}break;case"childList":if(a[r].addedNodes.length>0){for(let e=0;e<a[r].addedNodes.length;++e){let t=a[r].addedNodes[e];l(function(t){return function(){s(t,true)}}(t))}}break}}};var s=function(a,t){if(!(a instanceof HTMLElement))return;if(e.indexOf(a)>-1)return;for(let r=0;r<i.attributes.length;++r){let e=a.getAttribute(i.attributes[r]);if(e){let t=i.attributeRegex.exec(e);if(t){a.setAttribute("nitro-lazy-"+i.attributes[r],u(t[1]));if(a.className.indexOf("nitro-lazy")<0){a.className+=" nitro-lazy"}}}}if(a.style.backgroundImage){let t=i.cssUrlFuncRegex.exec(a.style.backgroundImage);if(t){a.setAttribute("nitro-lazy-bg",u(t[1]));if(a.className.indexOf("nitro-lazy")<0){a.className+=" nitro-lazy"}}}e.push(a);if(t){a.querySelectorAll("*").forEach(function(t){l(function(){s(t)})})}};function u(t){return a[t]}if(i.enabled){t()}})();</script> <div id="page_preloader"><div class="preloader_wrap preloader_circle"><div class="preloader_circ1"></div><div class="preloader_circ2"></div><div class="preloader_circ3"></div><div class="preloader_circ4"></div></div></div> <template data-nitro-marker-id="e51f213f7e024ee6b30f4932a6f6d9ae-1"></template> <template data-nitro-marker-id="f56edcf4f4048a2b7e993a593629691c-1"></template> <noscript> <div style="display:inline;"> <img height="1" width="1" style="border-style:none;" alt="" src="//googleads.g.doubleclick.net/pagead/viewthroughconversion/807194730/?guid=ON&amp;script=0"/> </div> </noscript> <template data-nitro-marker-id="f99b89b4647fb366ec1e3f2595305b9b-1"></template> <template data-nitro-marker-id="e46ae0b19dfd4f911b68d2accfe3ae31-1"></template> <template data-nitro-marker-id="ce0e37ba6dd35f3848785cc7d29fa29d-1"></template> <div class="joinchat joinchat--right joinchat--btn" data-settings='{"telephone":"33755522636","mobile_only":false,"button_delay":3,"whatsapp_web":true,"qr":false,"message_views":2,"message_delay":10,"message_badge":false,"message_send":"Chirurgies esthétique en Tunisie","message_hash":""}'> <div class="joinchat__button"> <div class="joinchat__button__open"></div> </div> </div> <noscript><img height="1" width="1" style="display: none;" src="https://www.facebook.com/tr?id=373716691486944&ev=PageView&noscript=1&eid=373716691486944cc75fbce-928e-4128-9974-92324329d3bd&cd%5Bpage_title%5D=Accueil&cd%5Bpost_type%5D=page&cd%5Bpost_id%5D=319&cd%5Bplugin%5D=PixelYourSite&cd%5Bevent_url%5D=www.chirurgies-esthetique-entunisie.com%2F&cd%5Buser_role%5D=guest" alt="facebook_pixel"></noscript> <template data-nitro-marker-id="regenerator-runtime-js"></template> <template data-nitro-marker-id="wp-polyfill-js"></template> <template data-nitro-marker-id="contact-form-7-js-extra"></template> <template data-nitro-marker-id="contact-form-7-js"></template> <template data-nitro-marker-id="nbcpf-intlTelInput-script-js"></template> <template data-nitro-marker-id="nbcpf-countryFlag-script-js"></template> <template data-nitro-marker-id="nbcpf-countryFlag-script-js-after"></template> <template data-nitro-marker-id="swiperslider-js"></template> <template data-nitro-marker-id="magnific-popup-js"></template> <template data-nitro-marker-id="trx_addons-js-extra"></template> <template data-nitro-marker-id="trx_addons-js"></template> <template data-nitro-marker-id="isida-parent-script-js"></template> <template data-nitro-marker-id="joinchat-js"></template> <template data-nitro-marker-id="isida-init-js-extra"></template> <template data-nitro-marker-id="isida-init-js"></template> <template data-nitro-marker-id="mediaelement-core-js-before"></template> <template data-nitro-marker-id="mediaelement-core-js"></template> <template data-nitro-marker-id="mediaelement-migrate-js"></template> <template data-nitro-marker-id="mediaelement-js-extra"></template> <template data-nitro-marker-id="wp-mediaelement-js"></template> <template data-nitro-marker-id="wpb_composer_front_js-js"></template> <template data-nitro-marker-id="sp-ea-accordion-js-js"></template> <template data-nitro-marker-id="sp-ea-accordion-config-js-extra"></template> <template data-nitro-marker-id="sp-ea-accordion-config-js"></template> <script>NPRL.registerInlineScript("007bdc004a584be6cec2e166c680e2c5-1", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6ImFwcGxpY2F0aW9uXC9qYXZhc2NyaXB0IiwiaWQiOiIwMDdiZGMwMDRhNTg0YmU2Y2VjMmUxNjZjNjgwZTJjNS0xIn19");NPRL.registerInlineScript("e0180dfbd485b47e191020c018e0dfb3-1", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6ImUwMTgwZGZiZDQ4NWI0N2UxOTEwMjBjMDE4ZTBkZmIzLTEifX0=");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-includes/js/jquery/nitro-min-af6cb5bfb91ce2d78377e57c8d18ffc0.jquery.min.js", "jquery-core-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6ImpxdWVyeS1jb3JlLWpzIn19");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-includes/js/jquery/nitro-min-d6171631e2919215b5e490dc93564c56.jquery-migrate.min.js", "jquery-migrate-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6ImpxdWVyeS1taWdyYXRlLWpzIn19");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-includes/js/jquery/ui/nitro-min-0028783c6c3493afecf62f0ca754461e.core.min.js", "jquery-ui-core-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6ImpxdWVyeS11aS1jb3JlLWpzIn19");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/plugins/gallery-videos/JS/nitro-min-37ad82ec6e267e01e51d5d41971977a8.modernizr.custom.js", "cwp-main-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6ImN3cC1tYWluLWpzIn19");NPRL.registerInlineScript("Total_Soft_Gallery_Video-js-extra", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6IlRvdGFsX1NvZnRfR2FsbGVyeV9WaWRlby1qcy1leHRyYSJ9fQ==");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/plugins/gallery-videos/JS/nitro-min-37ad82ec6e267e01e51d5d41971977a8.Total-Soft-Gallery-Video-Widget.js", "Total_Soft_Gallery_Video-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6IlRvdGFsX1NvZnRfR2FsbGVyeV9WaWRlby1qcyJ9fQ==");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/plugins/wp-odoo-form-integrator/public/js/nitro-min-8a5471f88ca9c58e18cea05ebc9fe21a.wp-odoo-form-integrator-public.js", "wp-odoo-form-integrator-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6IndwLW9kb28tZm9ybS1pbnRlZ3JhdG9yLWpzIn19");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/plugins/pixelyoursite-super-pack/dist/scripts/nitro-min-7c454b02f72d4badb4ae7e0e69c76446.public.js", "pys_sp_public_js-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6InB5c19zcF9wdWJsaWNfanMtanMifX0=");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/plugins/pixelyoursite-pro/dist/scripts/nitro-min-4c715fc6d6093d42d209b7767647b52f.js.cookie-2.1.3.min.js", "js-cookie-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6ImpzLWNvb2tpZS1qcyJ9fQ==");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/plugins/pixelyoursite-pro/dist/scripts/nitro-min-37ad82ec6e267e01e51d5d41971977a8.jquery.bind-first-0.2.3.min.js", "jquery-bind-first-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6ImpxdWVyeS1iaW5kLWZpcnN0LWpzIn19");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/plugins/pixelyoursite-pro/dist/scripts/nitro-min-37ad82ec6e267e01e51d5d41971977a8.vimeo.min.js", "vimeo-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6InZpbWVvLWpzIn19");NPRL.registerInlineScript("pys-js-extra", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6InB5cy1qcy1leHRyYSJ9fQ==");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/plugins/pixelyoursite-pro/dist/scripts/nitro-min-edeb46865a52586eae35a1465d9b5828.public.js", "pys-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6InB5cy1qcyJ9fQ==");NPRL.registerInlineScript("cceb1fa34f70c378b8382e286f90a44d-1", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsiaWQiOiJjY2ViMWZhMzRmNzBjMzc4YjgzODJlMjg2ZjkwYTQ0ZC0xIn19");NPRL.registerInlineScript("a073bd1a6ae4babf61a3ecbf0db0a14d-1", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6ImEwNzNiZDFhNmFlNGJhYmY2MWEzZWNiZjBkYjBhMTRkLTEifX0=");NPRL.registerInlineScript("74fb6f3bb3222fe37a8f8b9535b9bf52-1", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsiaWQiOiI3NGZiNmYzYmIzMjIyZmUzN2E4ZjhiOTUzNWI5YmY1Mi0xIn19");NPRL.registerInlineScript("e51f213f7e024ee6b30f4932a6f6d9ae-1", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6ImU1MWYyMTNmN2UwMjRlZTZiMzBmNDkzMmE2ZjZkOWFlLTEifX0=");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/pagead/nitro-min-conversion.js", "f56edcf4f4048a2b7e993a593629691c-1", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6ImY1NmVkY2Y0ZjQwNDhhMmI3ZTk5M2E1OTM2Mjk2OTFjLTEifX0=");NPRL.registerInlineScript("f99b89b4647fb366ec1e3f2595305b9b-1", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6ImY5OWI4OWI0NjQ3ZmIzNjZlYzFlM2YyNTk1MzA1YjliLTEifX0=");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/recaptcha/nitro-min-d045d261ce2cda151c1669475bf4095d.api.js", "e46ae0b19dfd4f911b68d2accfe3ae31-1", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsiYXN5bmMiOmZhbHNlLCJkZWZlciI6ZmFsc2UsImlkIjoiZTQ2YWUwYjE5ZGZkNGY5MTFiNjhkMmFjY2ZlM2FlMzEtMSJ9fQ==");NPRL.registerInlineScript("ce0e37ba6dd35f3848785cc7d29fa29d-1", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6ImNlMGUzN2JhNmRkMzVmMzg0ODc4NWNjN2QyOWZhMjlkLTEifX0=");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-includes/js/dist/vendor/nitro-min-39373f825d7812e4c0eff141ce43ad5b.regenerator-runtime.min.js", "regenerator-runtime-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6InJlZ2VuZXJhdG9yLXJ1bnRpbWUtanMifX0=");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-includes/js/dist/vendor/nitro-min-2c7cef87d91a8c32817cef0915f9141b.wp-polyfill.min.js", "wp-polyfill-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6IndwLXBvbHlmaWxsLWpzIn19");NPRL.registerInlineScript("contact-form-7-js-extra", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6ImNvbnRhY3QtZm9ybS03LWpzLWV4dHJhIn19");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/plugins/contact-form-7/includes/js/nitro-min-d96de4b09394b22797f39fa091802ce1.index.js", "contact-form-7-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6ImNvbnRhY3QtZm9ybS03LWpzIn19");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/plugins/country-phone-field-contact-form-7/assets/js/nitro-min-37ad82ec6e267e01e51d5d41971977a8.intlTelInput.min.js", "nbcpf-intlTelInput-script-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6Im5iY3BmLWludGxUZWxJbnB1dC1zY3JpcHQtanMifX0=");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/plugins/country-phone-field-contact-form-7/assets/js/nitro-min-37ad82ec6e267e01e51d5d41971977a8.countrySelect.min.js", "nbcpf-countryFlag-script-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6Im5iY3BmLWNvdW50cnlGbGFnLXNjcmlwdC1qcyJ9fQ==");NPRL.registerInlineScript("nbcpf-countryFlag-script-js-after", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6Im5iY3BmLWNvdW50cnlGbGFnLXNjcmlwdC1qcy1hZnRlciJ9fQ==");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/plugins/trx_addons/js/swiper/nitro-min-swiper.jquery.min.js", "swiperslider-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6InN3aXBlcnNsaWRlci1qcyJ9fQ==");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/plugins/trx_addons/js/magnific/nitro-min-37ad82ec6e267e01e51d5d41971977a8.jquery.magnific-popup.min.js", "magnific-popup-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6Im1hZ25pZmljLXBvcHVwLWpzIn19");NPRL.registerInlineScript("trx_addons-js-extra", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6InRyeF9hZGRvbnMtanMtZXh0cmEifX0=");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/plugins/trx_addons/js/nitro-min-trx_addons.js", "trx_addons-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6InRyeF9hZGRvbnMtanMifX0=");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/themes/isida-child/js/nitro-min-fe9d096be33b4b2c8e343ea67c9680d7.scripts.js", "isida-parent-script-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6ImlzaWRhLXBhcmVudC1zY3JpcHQtanMifX0=");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/plugins/creame-whatsapp-me/public/js/nitro-min-face87b3a2efbbbe9ba5c82374ba64f8.joinchat.min.js", "joinchat-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6ImpvaW5jaGF0LWpzIn19");NPRL.registerInlineScript("isida-init-js-extra", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6ImlzaWRhLWluaXQtanMtZXh0cmEifX0=");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/themes/isida/js/nitro-min-__scripts.js", "isida-init-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6ImlzaWRhLWluaXQtanMifX0=");NPRL.registerInlineScript("mediaelement-core-js-before", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6Im1lZGlhZWxlbWVudC1jb3JlLWpzLWJlZm9yZSJ9fQ==");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-includes/js/mediaelement/nitro-min-08e1ccd7c6127adb473bcf63417af6f4.mediaelement-and-player.min.js", "mediaelement-core-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6Im1lZGlhZWxlbWVudC1jb3JlLWpzIn19");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-includes/js/mediaelement/nitro-min-37ad82ec6e267e01e51d5d41971977a8.mediaelement-migrate.min.js", "mediaelement-migrate-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6Im1lZGlhZWxlbWVudC1taWdyYXRlLWpzIn19");NPRL.registerInlineScript("mediaelement-js-extra", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6Im1lZGlhZWxlbWVudC1qcy1leHRyYSJ9fQ==");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-includes/js/mediaelement/nitro-min-37ad82ec6e267e01e51d5d41971977a8.wp-mediaelement.min.js", "wp-mediaelement-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6IndwLW1lZGlhZWxlbWVudC1qcyJ9fQ==");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/plugins/js_composer/assets/js/dist/nitro-min-40df0bcacd5f4b6da3e6fc2dad5906a5.js_composer_front.min.js", "wpb_composer_front_js-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6IndwYl9jb21wb3Nlcl9mcm9udF9qcy1qcyJ9fQ==");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/plugins/easy-accordion-free/public/assets/js/nitro-min-4e10740ddab857877c907b5d6cc94817.collapse.min.js", "sp-ea-accordion-js-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6InNwLWVhLWFjY29yZGlvbi1qcy1qcyJ9fQ==");NPRL.registerInlineScript("sp-ea-accordion-config-js-extra", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6InNwLWVhLWFjY29yZGlvbi1jb25maWctanMtZXh0cmEifX0=");NPRL.registerScript("https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/wp-content/plugins/easy-accordion-free/public/assets/js/nitro-min-4e10740ddab857877c907b5d6cc94817.script.js", "sp-ea-accordion-config-js", "eyJkZWxheSI6ZmFsc2UsImF0dHJpYnV0ZXMiOnsidHlwZSI6InRleHRcL2phdmFzY3JpcHQiLCJpZCI6InNwLWVhLWFjY29yZGlvbi1jb25maWctanMifX0=");</script><noscript id="nitro-deferred-styles"><style type="text/css" onload="NPRL.onLoadStyle(this)" onerror="NPRL.onErrorStyle(this)">img.wp-smiley,img.emoji{display:inline !important;border:none !important;box-shadow:none !important;height:1em !important;width:1em !important;margin:0 .07em !important;vertical-align:-.1em !important;background:none !important;padding:0 !important;}</style><link rel="stylesheet" onload="NPRL.onLoadStyle(this)" onerror="NPRL.onErrorStyle(this)" href="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/combinedCss/nitro-min-noimport-5684cc7b68507bd555f6768808b3c627-stylesheet.css" /><style id='joinchat-button-style-inline-css' type='text/css' onload="NPRL.onLoadStyle(this)" onerror="NPRL.onErrorStyle(this)">.wp-block-joinchat-button{border:none !important;text-align:center;}.wp-block-joinchat-button figure{display:table;margin:0 auto;padding:0;}.wp-block-joinchat-button figcaption{font:normal normal 400 .6em/2em var(--wp--preset--font-family--system-font,sans-serif);margin:0;padding:0;}.wp-block-joinchat-button .joinchat-button__qr{background-color:#fff;border:6px solid #25d366;border-radius:30px;box-sizing:content-box;display:block;height:200px;margin:auto;overflow:hidden;padding:10px;width:200px;}.wp-block-joinchat-button .joinchat-button__qr canvas,.wp-block-joinchat-button .joinchat-button__qr img{display:block;margin:auto;}.wp-block-joinchat-button .joinchat-button__link{align-items:center;background-color:#25d366;border:6px solid #25d366;border-radius:30px;display:inline-flex;flex-flow:row nowrap;justify-content:center;line-height:1.25em;margin:0 auto;text-decoration:none;}.wp-block-joinchat-button .joinchat-button__link:before{background:transparent var(--joinchat-ico) no-repeat center;background-size:100%;content:"";display:block;height:1.5em;margin:-.75em .75em -.75em 0;width:1.5em;}.wp-block-joinchat-button figure+.joinchat-button__link{margin-top:10px;}@media (orientation:landscape)and (min-height:481px),(orientation:portrait)and (min-width:481px){.wp-block-joinchat-button.joinchat-button--qr-only figure+.joinchat-button__link{display:none;}}@media (max-width:480px),(orientation:landscape)and (max-height:480px){.wp-block-joinchat-button figure{display:none;}}</style><style id='global-styles-inline-css' type='text/css' onload="NPRL.onLoadStyle(this)" onerror="NPRL.onErrorStyle(this)">body{--wp--preset--color--black:#000;--wp--preset--color--cyan-bluish-gray:#abb8c3;--wp--preset--color--white:#fff;--wp--preset--color--pale-pink:#f78da7;--wp--preset--color--vivid-red:#cf2e2e;--wp--preset--color--luminous-vivid-orange:#ff6900;--wp--preset--color--luminous-vivid-amber:#fcb900;--wp--preset--color--light-green-cyan:#7bdcb5;--wp--preset--color--vivid-green-cyan:#00d084;--wp--preset--color--pale-cyan-blue:#8ed1fc;--wp--preset--color--vivid-cyan-blue:#0693e3;--wp--preset--color--vivid-purple:#9b51e0;--wp--preset--gradient--vivid-cyan-blue-to-vivid-purple:linear-gradient(135deg,rgba(6,147,227,1) 0%,#9b51e0 100%);--wp--preset--gradient--light-green-cyan-to-vivid-green-cyan:linear-gradient(135deg,#7adcb4 0%,#00d082 100%);--wp--preset--gradient--luminous-vivid-amber-to-luminous-vivid-orange:linear-gradient(135deg,rgba(252,185,0,1) 0%,rgba(255,105,0,1) 100%);--wp--preset--gradient--luminous-vivid-orange-to-vivid-red:linear-gradient(135deg,rgba(255,105,0,1) 0%,#cf2e2e 100%);--wp--preset--gradient--very-light-gray-to-cyan-bluish-gray:linear-gradient(135deg,#eee 0%,#a9b8c3 100%);--wp--preset--gradient--cool-to-warm-spectrum:linear-gradient(135deg,#4aeadc 0%,#9778d1 20%,#cf2aba 40%,#ee2c82 60%,#fb6962 80%,#fef84c 100%);--wp--preset--gradient--blush-light-purple:linear-gradient(135deg,#ffceec 0%,#9896f0 100%);--wp--preset--gradient--blush-bordeaux:linear-gradient(135deg,#fecda5 0%,#fe2d2d 50%,#6b003e 100%);--wp--preset--gradient--luminous-dusk:linear-gradient(135deg,#ffcb70 0%,#c751c0 50%,#4158d0 100%);--wp--preset--gradient--pale-ocean:linear-gradient(135deg,#fff5cb 0%,#b6e3d4 50%,#33a7b5 100%);--wp--preset--gradient--electric-grass:linear-gradient(135deg,#caf880 0%,#71ce7e 100%);--wp--preset--gradient--midnight:linear-gradient(135deg,#020381 0%,#2874fc 100%);--wp--preset--duotone--dark-grayscale:url("#wp-duotone-dark-grayscale");--wp--preset--duotone--grayscale:url("#wp-duotone-grayscale");--wp--preset--duotone--purple-yellow:url("#wp-duotone-purple-yellow");--wp--preset--duotone--blue-red:url("#wp-duotone-blue-red");--wp--preset--duotone--midnight:url("#wp-duotone-midnight");--wp--preset--duotone--magenta-yellow:url("#wp-duotone-magenta-yellow");--wp--preset--duotone--purple-green:url("#wp-duotone-purple-green");--wp--preset--duotone--blue-orange:url("#wp-duotone-blue-orange");--wp--preset--font-size--small:13px;--wp--preset--font-size--medium:20px;--wp--preset--font-size--large:36px;--wp--preset--font-size--x-large:42px;}.has-black-color{color:var(--wp--preset--color--black) !important;}.has-cyan-bluish-gray-color{color:var(--wp--preset--color--cyan-bluish-gray) !important;}.has-white-color{color:var(--wp--preset--color--white) !important;}.has-pale-pink-color{color:var(--wp--preset--color--pale-pink) !important;}.has-vivid-red-color{color:var(--wp--preset--color--vivid-red) !important;}.has-luminous-vivid-orange-color{color:var(--wp--preset--color--luminous-vivid-orange) !important;}.has-luminous-vivid-amber-color{color:var(--wp--preset--color--luminous-vivid-amber) !important;}.has-light-green-cyan-color{color:var(--wp--preset--color--light-green-cyan) !important;}.has-vivid-green-cyan-color{color:var(--wp--preset--color--vivid-green-cyan) !important;}.has-pale-cyan-blue-color{color:var(--wp--preset--color--pale-cyan-blue) !important;}.has-vivid-cyan-blue-color{color:var(--wp--preset--color--vivid-cyan-blue) !important;}.has-vivid-purple-color{color:var(--wp--preset--color--vivid-purple) !important;}.has-black-background-color{background-color:var(--wp--preset--color--black) !important;}.has-cyan-bluish-gray-background-color{background-color:var(--wp--preset--color--cyan-bluish-gray) !important;}.has-white-background-color{background-color:var(--wp--preset--color--white) !important;}.has-pale-pink-background-color{background-color:var(--wp--preset--color--pale-pink) !important;}.has-vivid-red-background-color{background-color:var(--wp--preset--color--vivid-red) !important;}.has-luminous-vivid-orange-background-color{background-color:var(--wp--preset--color--luminous-vivid-orange) !important;}.has-luminous-vivid-amber-background-color{background-color:var(--wp--preset--color--luminous-vivid-amber) !important;}.has-light-green-cyan-background-color{background-color:var(--wp--preset--color--light-green-cyan) !important;}.has-vivid-green-cyan-background-color{background-color:var(--wp--preset--color--vivid-green-cyan) !important;}.has-pale-cyan-blue-background-color{background-color:var(--wp--preset--color--pale-cyan-blue) !important;}.has-vivid-cyan-blue-background-color{background-color:var(--wp--preset--color--vivid-cyan-blue) !important;}.has-vivid-purple-background-color{background-color:var(--wp--preset--color--vivid-purple) !important;}.has-black-border-color{border-color:var(--wp--preset--color--black) !important;}.has-cyan-bluish-gray-border-color{border-color:var(--wp--preset--color--cyan-bluish-gray) !important;}.has-white-border-color{border-color:var(--wp--preset--color--white) !important;}.has-pale-pink-border-color{border-color:var(--wp--preset--color--pale-pink) !important;}.has-vivid-red-border-color{border-color:var(--wp--preset--color--vivid-red) !important;}.has-luminous-vivid-orange-border-color{border-color:var(--wp--preset--color--luminous-vivid-orange) !important;}.has-luminous-vivid-amber-border-color{border-color:var(--wp--preset--color--luminous-vivid-amber) !important;}.has-light-green-cyan-border-color{border-color:var(--wp--preset--color--light-green-cyan) !important;}.has-vivid-green-cyan-border-color{border-color:var(--wp--preset--color--vivid-green-cyan) !important;}.has-pale-cyan-blue-border-color{border-color:var(--wp--preset--color--pale-cyan-blue) !important;}.has-vivid-cyan-blue-border-color{border-color:var(--wp--preset--color--vivid-cyan-blue) !important;}.has-vivid-purple-border-color{border-color:var(--wp--preset--color--vivid-purple) !important;}.has-vivid-cyan-blue-to-vivid-purple-gradient-background{background:var(--wp--preset--gradient--vivid-cyan-blue-to-vivid-purple) !important;}.has-light-green-cyan-to-vivid-green-cyan-gradient-background{background:var(--wp--preset--gradient--light-green-cyan-to-vivid-green-cyan) !important;}.has-luminous-vivid-amber-to-luminous-vivid-orange-gradient-background{background:var(--wp--preset--gradient--luminous-vivid-amber-to-luminous-vivid-orange) !important;}.has-luminous-vivid-orange-to-vivid-red-gradient-background{background:var(--wp--preset--gradient--luminous-vivid-orange-to-vivid-red) !important;}.has-very-light-gray-to-cyan-bluish-gray-gradient-background{background:var(--wp--preset--gradient--very-light-gray-to-cyan-bluish-gray) !important;}.has-cool-to-warm-spectrum-gradient-background{background:var(--wp--preset--gradient--cool-to-warm-spectrum) !important;}.has-blush-light-purple-gradient-background{background:var(--wp--preset--gradient--blush-light-purple) !important;}.has-blush-bordeaux-gradient-background{background:var(--wp--preset--gradient--blush-bordeaux) !important;}.has-luminous-dusk-gradient-background{background:var(--wp--preset--gradient--luminous-dusk) !important;}.has-pale-ocean-gradient-background{background:var(--wp--preset--gradient--pale-ocean) !important;}.has-electric-grass-gradient-background{background:var(--wp--preset--gradient--electric-grass) !important;}.has-midnight-gradient-background{background:var(--wp--preset--gradient--midnight) !important;}.has-small-font-size{font-size:var(--wp--preset--font-size--small) !important;}.has-medium-font-size{font-size:var(--wp--preset--font-size--medium) !important;}.has-large-font-size{font-size:var(--wp--preset--font-size--large) !important;}.has-x-large-font-size{font-size:var(--wp--preset--font-size--x-large) !important;}</style><link rel="stylesheet" onload="NPRL.onLoadStyle(this)" onerror="NPRL.onErrorStyle(this)" href="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/combinedCss/nitro-min-noimport-e2be4fd3e59aeff9698e4b1b8b6f96fa-stylesheet.css" /><style id='sp-ea-style-inline-css' type='text/css' onload="NPRL.onLoadStyle(this)" onerror="NPRL.onErrorStyle(this)">#sp-ea-4002 .spcollapsing{height:0;overflow:hidden;transition-property:height;transition-duration:300ms;}#sp-ea-4002.sp-easy-accordion>.sp-ea-single{border:1px solid #e2e2e2;}#sp-ea-4002.sp-easy-accordion>.sp-ea-single>.ea-header a{color:#444;}#sp-ea-4002.sp-easy-accordion>.sp-ea-single>.sp-collapse>.ea-body{background:#fff;color:#444;}#sp-ea-4002.sp-easy-accordion>.sp-ea-single{background:#eee;}#sp-ea-4002.sp-easy-accordion>.sp-ea-single>.ea-header a .ea-expand-icon.fa{float:left;color:#444;font-size:16px;}</style><link rel="stylesheet" onload="NPRL.onLoadStyle(this)" onerror="NPRL.onErrorStyle(this)" href="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/combinedCss/nitro-min-noimport-f94043f3817cf3ca41f61fe18d12907b-stylesheet.css" /><style type="text/css" onload="NPRL.onLoadStyle(this)" onerror="NPRL.onErrorStyle(this)">.recentcomments a{display:inline !important;padding:0 !important;margin:0 !important;}</style><style type="text/css" id="custom-background-css" onload="NPRL.onLoadStyle(this)" onerror="NPRL.onErrorStyle(this)">body.custom-background{background-color:#e0e2e3;}</style><style type="text/css" data-type="vc_shortcodes-custom-css" onload="NPRL.onLoadStyle(this)" onerror="NPRL.onErrorStyle(this)">.vc_custom_1520503636019{background-position:center !important;background-repeat:no-repeat !important;background-size:cover !important;}.vc_custom_1638370981015{margin-bottom:20px !important;}.vc_custom_1638370981015{margin-bottom:20px !important;}.vc_custom_1638370981015{margin-bottom:20px !important;}.vc_custom_1638370981015{margin-bottom:20px !important;}.vc_custom_1638291476769{background-color:#f7f7f7 !important;}.vc_custom_1658328834146{padding-top:22px !important;}.vc_custom_1657786695749{padding-top:22px !important;}.vc_custom_1650894408947{padding-top:10px !important;}.vc_custom_1650894415376{padding-top:10px !important;}.vc_custom_1650894422876{padding-top:10px !important;}.vc_custom_1657786717341{padding-top:25px !important;}.vc_custom_1658328775244{padding-bottom:10px !important;}.vc_custom_1658328796053{padding-top:15px !important;}.vc_custom_1657786907220{padding-top:25px !important;}.vc_custom_1652885640847{margin-top:20px !important;}.vc_custom_1652885640847{margin-top:20px !important;}.vc_custom_1657787339073{margin-top:20px !important;}.vc_custom_1651756118013{padding-top:10px !important;}.vc_custom_1651756155742{padding-top:13px !important;}.vc_custom_1651756164787{padding-top:13px !important;}.vc_custom_1651756177009{padding-top:10px !important;}</style><style type="text/css" onload="NPRL.onLoadStyle(this)" onerror="NPRL.onErrorStyle(this)">.vc_btn3-style-gradient-custom.vc_btn-gradient-btn-62f1342964a4d:hover{color:#fff;background-color:#23a7de;border:none;background-position:100% 0;}</style><style type="text/css" onload="NPRL.onLoadStyle(this)" onerror="NPRL.onErrorStyle(this)">.vc_btn3-style-gradient-custom.vc_btn-gradient-btn-62f1342964a4d{color:#fff;border:none;background-color:#ff6867;background-image:-webkit-linear-gradient(left,#ff6867 0%,#23a7de 50%,#ff6867 100%);background-image:linear-gradient(to right,#ff6867 0%,#23a7de 50%,#ff6867 100%);-webkit-transition:all .2s ease-in-out;transition:all .2s ease-in-out;background-size:200% 100%;}</style><style type="text/css" onload="NPRL.onLoadStyle(this)" onerror="NPRL.onErrorStyle(this)">.vc_btn3-style-gradient-custom.vc_btn-gradient-btn-62f13429659fc:hover{color:#fff;background-color:#23a7de;border:none;background-position:100% 0;}</style><style type="text/css" onload="NPRL.onLoadStyle(this)" onerror="NPRL.onErrorStyle(this)">.vc_btn3-style-gradient-custom.vc_btn-gradient-btn-62f13429659fc{color:#fff;border:none;background-color:#ff6867;background-image:-webkit-linear-gradient(left,#ff6867 0%,#23a7de 50%,#ff6867 100%);background-image:linear-gradient(to right,#ff6867 0%,#23a7de 50%,#ff6867 100%);-webkit-transition:all .2s ease-in-out;transition:all .2s ease-in-out;background-size:200% 100%;}</style><link rel="stylesheet" onload="NPRL.onLoadStyle(this)" onerror="NPRL.onErrorStyle(this)" href="https://cdn-fflki.nitrocdn.com/odvKjWqDflyKLSWUsVLQaoMBSQxJsvaI/assets/static/optimized/rev-7c1dd13/combinedCss/nitro-min-noimport-587256d4136a9f9f17480c7a606e2aa8-stylesheet.css" /></noscript><script id="nitro-boot-resource-loader">NPRL.boot();</script><script>(function(){let d=Math.max(document.documentElement.clientHeight||0,window.innerHeight||0);let o=[];function f(t){if(t===null)return;let e=null;let n=t.children.length;let i;let l=["SCRIPT","STYLE","LINK","TEMPLATE"];for(let e=0;e<n;e++){i=t.children[e];if(l.indexOf(i.tagName)==-1){let e=i.getBoundingClientRect();if(e.width*e.height>0){if(e.y>d){o.push(i)}else{f(i)}}}}}if(typeof NPRL!=="undefined"){f(document.body);let t=o.length;let n;for(let e=1;e<t;e++){n=o[e];n.classList.add("nitro-offscreen")}let e=false;function i(){if(!e){document.getElementById("nitro-preloader").remove();e=true}}window.addEventListener("NitroStylesLoaded",i);setTimeout(i,3e3)}})();</script><style id="nitro-preloader">.nitro-offscreen { display: none !important; }</style><template id="TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3"> <style>
  * {
  vertical-align: baseline;
  font-weight: inherit;
  font-family: inherit;
  line-height: 1.3rem;
  font-style: inherit;
  font-size: 100%;
  border: 0 none;
  outline: 0;
  padding: 0;
  margin: 0;
}

.TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3 {
  display: -webkit-flex;
  display: -ms-flex;
  display: flex;
  flex-flow: row nowrap;
  justify-content: center;
  align-items: center;
  align-content: center;
  font-family: sans-serif;
  height: 35px;
  overflow: hidden;
  width: 100%;
  clear: both;
}

.TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3theme--light {
  background: #fff;
  color: #454545;
}

.TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3theme--dark {
  background: #272727;
  color: #fff;
}

.TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3theme--light .TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3link {
  cursor:pointer;
  text-decoration: none;
  color: #454545;
}

.TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3theme--dark .TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3link {
  cursor:pointer;
  text-decoration: none;
  color: #fff;
}

.TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3logo {
  text-align: right;
  padding-right: 20px;
  align-self: center;
  line-height:0;
  border-right: 1px solid rgba(152, 152, 152, 0.45);
}

.TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3message {
  text-align: left;
  padding-left: 20px;
  align-self: center;
}

.TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3message p {
  margin: 0;
}

@media only screen and (max-width: 767px) {
  .TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3logo {
    padding-right: 10px;
  }
  .TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3message {
    padding-left: 10px;
  }
}

@media only screen and (max-width: 549px) {
  .TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3logo {
    padding: 0 5px;
  }
  .TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3message p {
    font-size: 12px;
    padding-right: 5px;
  }
}

@media only screen and (max-width: 320px) and (orientation: portrait) {
  .TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3message p {
    font-size: 11px;
    padding-right: 0px;
  }
}

  </style> <div class="TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3 TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3theme--light" data-nosnippet> <div class="TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3logo"> <span onclick="window.open('https://www.nitropack.io/', '_blank')" class="TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3link"> <img src="data:image/svg+xml;base64,PHN2ZyBpZD0iTGF5ZXJfMSIgZGF0YS1uYW1lPSJMYXllciAxIiB4bWxucz0iaHR0cDovL3d3dy53My5vcmcvMjAwMC9zdmciIHZpZXdCb3g9IjAgMCA1MzcgOTEiPjxkZWZzPjxzdHlsZT4uY2xzLTF7ZmlsbDpub25lO3N0cm9rZTojNzhjMTRkO3N0cm9rZS1taXRlcmxpbWl0OjEwO3N0cm9rZS13aWR0aDoxMHB4O30uY2xzLTJ7ZmlsbDojNzhjMTRkO30uY2xzLTN7ZmlsbDojOTg5ODk3O308L3N0eWxlPjwvZGVmcz48dGl0bGU+bG9nby1saWdodDwvdGl0bGU+PHBhdGggY2xhc3M9ImNscy0xIiBkPSJNNS41LDgyLjQ3YTc0LjI1LDc0LjI1LDAsMCwxLDE0OC41LDAiLz48cG9seWdvbiBjbGFzcz0iY2xzLTIiIHBvaW50cz0iNzQuNDMgNzAuMjkgMTE1LjgyIDQwLjM0IDg2LjU1IDgxLjA0IDc0LjQzIDcwLjI5Ii8+PGNpcmNsZSBjbGFzcz0iY2xzLTIiIGN4PSI3OC42NiIgY3k9Ijc3LjA0IiByPSIxMS41NSIvPjxwYXRoIGNsYXNzPSJjbHMtMyIgZD0iTTE3OC42Nyw4Mi42VjM5LjY1aDguNDNsMTcuNTgsMjguNjhWMzkuNjVoOC4wNlY4Mi42SDIwNGwtMTcuMzItMjh2MjhaIi8+PHBhdGggY2xhc3M9ImNscy0zIiBkPSJNMjIxLjg1LDQ3LjI2VjM5LjY1aDguMjN2Ny42MVptMCwzNS4zNFY1MS40OGg4LjIzVjgyLjZaIi8+PHBhdGggY2xhc3M9ImNscy0zIiBkPSJNMjUyLjc5LDUxLjQ4VjU4aC01LjYzVjcwLjU4YTMyLjYxLDMyLjYxLDAsMCwwLC4xNiw0LjQ0LDEuNzgsMS43OCwwLDAsMCwuNzQsMSwyLjI3LDIuMjcsMCwwLDAsMS4zOS40MSwxMC42LDEwLjYsMCwwLDAsMy4zMS0uNzlsLjcsNi4zOUExNi4zNCwxNi4zNCwwLDAsMSwyNDcsODMuM2ExMC4yOSwxMC4yOSwwLDAsMS00LS43NSw1Ljg5LDUuODksMCwwLDEtMi42Mi0xLjkzLDcuNjUsNy42NSwwLDAsMS0xLjE2LTMuMjEsNDEsNDEsMCwwLDEtLjI2LTUuOFY1OGgtMy43OFY1MS40OGgzLjc4VjQ1LjNsOC4yNi00Ljh2MTFaIi8+PHBhdGggY2xhc3M9ImNscy0zIiBkPSJNMjY2LjM4LDgyLjZoLTguMjNWNTEuNDhoNy42NHY0LjQzYTEzLjE5LDEzLjE5LDAsMCwxLDMuNTQtNC4xMyw2LjQyLDYuNDIsMCwwLDEsMy41NS0xLDEwLjQ2LDEwLjQ2LDAsMCwxLDUuNDIsMS41NWwtMi41NCw3LjE4YTcuMjQsNy4yNCwwLDAsMC0zLjg3LTEuMzUsNC42LDQuNiwwLDAsMC0yLjkzLDEsNi41Nyw2LjU3LDAsMCwwLTEuODksMy40NWMtLjQ2LDEuNjYtLjY5LDUuMTMtLjY5LDEwLjQzWiIvPjxwYXRoIGNsYXNzPSJjbHMtMyIgZD0iTTI4MCw2Ni42YTE2LjgyLDE2LjgyLDAsMCwxLDItNy45NCwxMy44MywxMy44MywwLDAsMSw1LjcyLTUuODYsMTcsMTcsMCwwLDEsOC4yOC0yLDE1LjUzLDE1LjUzLDAsMCwxLDExLjU3LDQuNThBMTUuODQsMTUuODQsMCwwLDEsMzEyLjA1LDY3YTE2LDE2LDAsMCwxLTQuNTUsMTEuNzFBMTUuNDIsMTUuNDIsMCwwLDEsMjk2LDgzLjNhMTguMiwxOC4yLDAsMCwxLTguMTYtMS45M0ExMy4yMiwxMy4yMiwwLDAsMSwyODIsNzUuNywxOC44OSwxOC44OSwwLDAsMSwyODAsNjYuNlptOC40My40NGMwLDMuMDkuNzQsNS40NSwyLjIsNy4wOWE3LjE5LDcuMTksMCwwLDAsMTAuODMsMHEyLjE4LTIuNDYsMi4xOC03LjE1dC0yLjE4LTdhNy4xOSw3LjE5LDAsMCwwLTEwLjgzLDBDMjg5LjEyLDYxLjU5LDI4OC4zOCw2NCwyODguMzgsNjdaIi8+PHBhdGggY2xhc3M9ImNscy0zIiBkPSJNMzE4LjU2LDgyLjZWMzkuNjVoMTMuOTFxNy45MiwwLDEwLjMyLjY0QTExLjI5LDExLjI5LDAsMCwxLDM0OSw0NC41YTEzLjMsMTMuMywwLDAsMSwyLjQ5LDguMzZBMTQsMTQsMCwwLDEsMzUwLDU5LjUxYTExLjY1LDExLjY1LDAsMCwxLTMuNjQsNC4yMywxMi41NSwxMi41NSwwLDAsMS00LjUsMiw0OS42NSw0OS42NSwwLDAsMS05LC42MWgtNS42NVY4Mi42Wm04LjY3LTM1LjY5VjU5LjFIMzMyYzMuNDEsMCw1LjctLjIyLDYuODUtLjY3QTUuNjMsNS42MywwLDAsMCwzNDIuNTIsNTNhNS41OCw1LjU4LDAsMCwwLTEuMzctMy44Nyw2LDYsMCwwLDAtMy40OS0xLjksNDAuNzEsNDAuNzEsMCwwLDAtNi4yNC0uM1oiLz48cGF0aCBjbGFzcz0iY2xzLTMiIGQ9Ik0zNjQuNjcsNjFsLTcuNDctMS4zNEExMS42MiwxMS42MiwwLDAsMSwzNjEuNTQsNTNjMi0xLjQ1LDUuMDktMi4xNyw5LjE0LTIuMTdxNS41MSwwLDguMiwxLjNhOC4xOSw4LjE5LDAsMCwxLDMuNzksMy4zMWMuNzQsMS4zNCwxLjEsMy44LDEuMSw3LjM3bC0uMDgsOS42MWEzMy43OSwzMy43OSwwLDAsMCwuMzksNiwxNy43MiwxNy43MiwwLDAsMCwxLjQ4LDQuMThoLTguMTRjLS4yMi0uNTUtLjQ4LTEuMzYtLjc5LTIuNDQtLjE0LS40OC0uMjQtLjgxLS4zLTFhMTQuODIsMTQuODIsMCwwLDEtNC41MSwzLjA3LDEyLjgxLDEyLjgxLDAsMCwxLTUuMTMsMSwxMC42LDEwLjYsMCwwLDEtNy41Ny0yLjYxLDguNjUsOC42NSwwLDAsMS0yLjc3LTYuNTksOC44Miw4LjgyLDAsMCwxLDEuMjYtNC43LDguMjksOC4yOSwwLDAsMSwzLjUzLTMuMTcsMjgsMjgsMCwwLDEsNi41NS0xLjkyLDQ0LjMzLDQ0LjMzLDAsMCwwLDgtMnYtLjgyYTQuMjUsNC4yNSwwLDAsMC0xLjE3LTMuMzhjLS43OS0uNjctMi4yNi0xLTQuNDMtMWE2LDYsMCwwLDAtMy40My44NkE2LjA1LDYuMDUsMCwwLDAsMzY0LjY3LDYxWm0xMSw2LjY4YTQ3LjYxLDQ3LjYxLDAsMCwxLTUsMS4yNiwxNSwxNSwwLDAsMC00LjQ4LDEuNDQsMy40MywzLjQzLDAsMCwwLTEuNjIsMi45LDQsNCwwLDAsMCwxLjI5LDMsNC41MSw0LjUxLDAsMCwwLDMuMjgsMS4yNkE3LjExLDcuMTEsMCwwLDAsMzczLjQsNzZhNS4xOSw1LjE5LDAsMCwwLDItMi43MiwxNi41NCwxNi41NCwwLDAsMCwuMzItNFoiLz48cGF0aCBjbGFzcz0iY2xzLTMiIGQ9Ik00MTksNjAuNjhsLTguMTIsMS40N0E1Ljg4LDUuODgsMCwwLDAsNDA5LDU4LjQ4YTUuNiw1LjYsMCwwLDAtMy43Ni0xLjIzLDYuMTUsNi4xNSwwLDAsMC00LjkxLDIuMTNxLTEuODMsMi4xMS0xLjgzLDcuMSwwLDUuNTMsMS44Niw3LjgyYTYuMDgsNi4wOCwwLDAsMCw1LDIuMjksNS41Miw1LjUyLDAsMCwwLDMuODQtMS4zMyw4LDgsMCwwLDAsMi4xMS00LjU5bDguMDksMS4zOGExNC4zNCwxNC4zNCwwLDAsMS00Ljg0LDguNDFRNDExLDgzLjI5LDQwNSw4My4zcS02LjgzLDAtMTAuODgtNC4zMXQtNC4wNi0xMS45MnEwLTcuNzEsNC4wNy0xMnQxMS00LjI5YzMuNzksMCw2LjguODEsOSwyLjQ1QTEzLjU5LDEzLjU5LDAsMCwxLDQxOSw2MC42OFoiLz48cGF0aCBjbGFzcz0iY2xzLTMiIGQ9Ik00MjUsODIuNlYzOS42NWg4LjI0VjYyLjQ0bDkuNjQtMTFINDUzTDQ0Mi4zNCw2Mi44NSw0NTMuNzMsODIuNmgtOC44N2wtNy44Mi0xNC0zLjg0LDR2MTBaIi8+PHBhdGggY2xhc3M9ImNscy0zIiBkPSJNNDU4LjYzLDgyLjZWNzQuMzZoOC4yM1Y4Mi42WiIvPjxwYXRoIGNsYXNzPSJjbHMtMyIgZD0iTTQ3NS4zLDQ3LjI2VjM5LjY1aDguMjN2Ny42MVptMCwzNS4zNFY1MS40OGg4LjIzVjgyLjZaIi8+PHBhdGggY2xhc3M9ImNscy0zIiBkPSJNNDkwLjA2LDY2LjZhMTYuOTQsMTYuOTQsMCwwLDEsMi03Ljk0LDEzLjkxLDEzLjkxLDAsMCwxLDUuNzMtNS44NiwxNywxNywwLDAsMSw4LjI4LTIsMTUuNTYsMTUuNTYsMCwwLDEsMTEuNTcsNC41OEExNS44NCwxNS44NCwwLDAsMSw1MjIuMTcsNjdhMTYuMDcsMTYuMDcsMCwwLDEtNC41NSwxMS43MSwxNS40MiwxNS40MiwwLDAsMS0xMS40Nyw0LjY0QTE4LjE3LDE4LjE3LDAsMCwxLDQ5OCw4MS4zN2ExMy4yOSwxMy4yOSwwLDAsMS01LjkxLTUuNjdBMTksMTksMCwwLDEsNDkwLjA2LDY2LjZabTguNDQuNDRxMCw0LjYzLDIuMiw3LjA5YTcuMTgsNy4xOCwwLDAsMCwxMC44MiwwcTIuMTktMi40NiwyLjE5LTcuMTV0LTIuMTktN2E3LjE4LDcuMTgsMCwwLDAtMTAuODIsMFE0OTguNSw2Mi40MSw0OTguNSw2N1oiLz48cGF0aCBjbGFzcz0iY2xzLTMiIGQ9Ik0xNzguNTMsMTguNjRxMC02LjQyLDMuNDQtMTBBMTEuNzIsMTEuNzIsMCwwLDEsMTkwLjg3LDVhMTIuMywxMi4zLDAsMCwxLDYuNDMsMS43MSwxMS4xNSwxMS4xNSwwLDAsMSw0LjM3LDQuNzUsMTUuNSwxNS41LDAsMCwxLDEuNSw2LjkyLDE1LjI3LDE1LjI3LDAsMCwxLTEuNTgsN0ExMC43OSwxMC43OSwwLDAsMSwxOTcuMTEsMzBhMTIuODMsMTIuODMsMCwwLDEtNi4yNiwxLjU5LDEyLjE4LDEyLjE4LDAsMCwxLTYuNS0xLjc2LDExLjM0LDExLjM0LDAsMCwxLTQuMzUtNC44QTE0LjU2LDE0LjU2LDAsMCwxLDE3OC41MywxOC42NFptMy41MS4wNUExMC4zMSwxMC4zMSwwLDAsMCwxODQuNTUsMjZhOC43NSw4Ljc1LDAsMCwwLDEyLjYyLDBxMi40OS0yLjcyLDIuNDktNy42OWExMy4yMSwxMy4yMSwwLDAsMC0xLjA3LTUuNDksOC4xNyw4LjE3LDAsMCwwLTMuMTEtMy42NCw4LjQ0LDguNDQsMCwwLDAtNC42LTEuMjksOC43Miw4LjcyLDAsMCwwLTYuMjMsMi40OUMxODIuOTEsMTIuMDUsMTgyLDE0LjgxLDE4MiwxOC42OVoiLz48cGF0aCBjbGFzcz0iY2xzLTMiIGQ9Ik0yMDcuNTcsMzEuMTlWNS40Mmg5LjcyYTIyLjgzLDIyLjgzLDAsMCwxLDMuOTIuMjUsNy44Miw3LjgyLDAsMCwxLDMuMTgsMS4yLDYuMzEsNi4zMSwwLDAsMSwyLjA2LDIuNDksNy44MSw3LjgxLDAsMCwxLC43OSwzLjUyLDcuOSw3LjksMCwwLDEtMi4xLDUuNTZjLTEuMzksMS41Mi0zLjkxLDIuMjctNy41NSwyLjI3SDIxMVYzMS4xOVpNMjExLDE3LjY3aDYuNjZjMi4yLDAsMy43Ny0uNDEsNC42OS0xLjIzQTQuMzYsNC4zNiwwLDAsMCwyMjMuNzIsMTNhNC42Myw0LjYzLDAsMCwwLS44Mi0yLjc3LDMuODEsMy44MSwwLDAsMC0yLjE1LTEuNTIsMTQuNjMsMTQuNjMsMCwwLDAtMy4xOC0uMjNIMjExWiIvPjxwYXRoIGNsYXNzPSJjbHMtMyIgZD0iTTIzOC4xMywzMS4xOVY4LjQ2aC04LjQ5di0zaDIwLjQzdjNoLTguNTNWMzEuMTlaIi8+PHBhdGggY2xhc3M9ImNscy0zIiBkPSJNMjU0LjE1LDMxLjE5VjUuNDJoMy40MVYzMS4xOVoiLz48cGF0aCBjbGFzcz0iY2xzLTMiIGQ9Ik0yNjMuNDYsMzEuMTlWNS40Mmg1LjE0bDYuMSwxOC4yNXEuODQsMi41NSwxLjIzLDMuODFjLjI5LS45NC43NS0yLjMxLDEuMzctNC4xM2w2LjE3LTE3LjkzaDQuNTlWMzEuMTloLTMuMjlWOS42MmwtNy40OSwyMS41N2gtMy4wN0wyNjYuNzUsOS4yNVYzMS4xOVoiLz48cGF0aCBjbGFzcz0iY2xzLTMiIGQ9Ik0yOTQuMTQsMzEuMTlWNS40MmgzLjQxVjMxLjE5WiIvPjxwYXRoIGNsYXNzPSJjbHMtMyIgZD0iTTMwMS41LDMxLjE5VjI4bDEzLjIxLTE2LjUxYTQwLjA2LDQwLjA2LDAsMCwxLDIuNjctMy4wNkgzMDN2LTNoMTguNDZ2M0wzMDcsMjYuMzRsLTEuNTcsMS44MWgxNi40NnYzWiIvPjxwYXRoIGNsYXNzPSJjbHMtMyIgZD0iTTMyNS42MiwzMS4xOVY1LjQyaDE4LjYzdjNIMzI5djcuOWgxNC4yNnYzSDMyOXY4Ljc3aDE1LjgydjNaIi8+PHBhdGggY2xhc3M9ImNscy0zIiBkPSJNMzQ5LjU2LDMxLjE5VjUuNDJoOC44OGEyMS4zNSwyMS4zNSwwLDAsMSw0LjU5LjM3LDguODIsOC44MiwwLDAsMSwzLjc4LDEuODUsMTAuNTIsMTAuNTIsMCwwLDEsMy4wNSw0LjQsMTcuMzksMTcuMzksMCwwLDEsMSw2LjEzLDE3Ljg5LDE3Ljg5LDAsMCwxLS42OSw1LjIsMTIuNTcsMTIuNTcsMCwwLDEtMS43NiwzLjc1LDkuMjcsOS4yNywwLDAsMS0yLjM0LDIuMzRBOS41LDkuNSwwLDAsMSwzNjMsMzAuNzVhMTcuNywxNy43LDAsMCwxLTQuMTQuNDRabTMuNDEtM2g1LjVhMTMuNTYsMTMuNTYsMCwwLDAsNC0uNDcsNS44Nyw1Ljg3LDAsMCwwLDIuMzItMS4zNCw4LjI1LDguMjUsMCwwLDAsMS44OC0zLjI2LDE1LjcxLDE1LjcxLDAsMCwwLC42OC01QTExLjk0LDExLjk0LDAsMCwwLDM2NiwxMS45LDYuNjUsNi42NSwwLDAsMCwzNjIuOCw5YTEzLjQsMTMuNCwwLDAsMC00LjQxLS41M0gzNTNaIi8+PHBhdGggY2xhc3M9ImNscy0zIiBkPSJNMzg1LjQyLDMxLjE5VjUuNDJoOS42N2ExMiwxMiwwLDAsMSw0Ljc0Ljc4LDYuMTMsNi4xMywwLDAsMSwyLjc5LDIuNDEsNi4zMSw2LjMxLDAsMCwxLDEsMy40LDUuOTMsNS45MywwLDAsMS0uODksMy4xMkE2LjQzLDYuNDMsMCwwLDEsNDAwLDE3LjQ4YTYuNzEsNi43MSwwLDAsMSwzLjU5LDIuMzQsNi4yNCw2LjI0LDAsMCwxLDEuMjYsMy45LDcuNTQsNy41NCwwLDAsMS0uNzYsMy4zNyw2LjY1LDYuNjUsMCwwLDEtMS44OSwyLjQsOCw4LDAsMCwxLTIuODIsMS4yNywxNy4xLDE3LjEsMCwwLDEtNC4xNi40M1ptMy40MS0xNC45NGg1LjU3YTEyLjQzLDEyLjQzLDAsMCwwLDMuMjYtLjMsMy42NCwzLjY0LDAsMCwwLDItMS4yOCwzLjcsMy43LDAsMCwwLC42Ni0yLjI1LDQuMTQsNC4xNCwwLDAsMC0uNjItMi4yNiwzLjEzLDMuMTMsMCwwLDAtMS43Ni0xLjM0QTE0LjY5LDE0LjY5LDAsMCwwLDM5NCw4LjQ2aC01LjE1Wm0wLDExLjloNi40MmExNS4xOSwxNS4xOSwwLDAsMCwyLjMyLS4xMiw1LjU4LDUuNTgsMCwwLDAsMi0uNzEsMy43LDMuNywwLDAsMCwxLjMtMS40Myw0LjQ5LDQuNDksMCwwLDAsLjUxLTIuMTcsNC4yNyw0LjI3LDAsMCwwLS43NC0yLjUsMy45MiwzLjkyLDAsMCwwLTIuMDUtMS41LDEyLjU5LDEyLjU5LDAsMCwwLTMuNzctLjQzaC02WiIvPjxwYXRoIGNsYXNzPSJjbHMtMyIgZD0iTTQxNi44MywzMS4xOVYyMC4yOEw0MDYuOSw1LjQyaDQuMTVsNS4wOCw3Ljc3Yy45NCwxLjQ1LDEuODEsMi45MSwyLjYyLDQuMzYuNzctMS4zNSwxLjcxLTIuODYsMi44MS00LjU1bDUtNy41OGg0TDQyMC4yNCwyMC4yOFYzMS4xOVoiLz48L3N2Zz4=" alt="Optimized by NitroPack.io" width="120" /> </span> </div> <div class="TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3message"> <p><span onclick="window.open('https://www.nitropack.io/', '_blank')" class="TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3link" target="_blank">Automated page speed optimizations for fast site performance</span></p> </div> </div> </template> <script>
  var template = document.getElementById("TFJmYZjMN0cMDNMMzkN2AlAxOTjuTc3");
  var div = document.createElement("div");
  div.setAttribute("style", "display: block !important; clear: both !important".replace(/\s/g, " ".repeat(parseInt(Math.random() * 29 + 1))));
  var shadow = div.attachShadow({mode: "closed"});
  shadow.innerHTML = template.innerHTML;
  document.body.appendChild(div);
</script> </body> </html>